| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:ARHGAP12-KDM1A |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: ARHGAP12-KDM1A | FusionPDB ID: 5932 | FusionGDB2.0 ID: 5932 | Hgene | Tgene | Gene symbol | ARHGAP12 | KDM1A | Gene ID | 94134 | 23028 |
| Gene name | Rho GTPase activating protein 12 | lysine demethylase 1A | |
| Synonyms | - | AOF2|BHC110|CPRF|KDM1|LSD1 | |
| Cytomap | 10p11.22 | 1p36.12 | |
| Type of gene | protein-coding | protein-coding | |
| Description | rho GTPase-activating protein 12rho-type GTPase-activating protein 12 | lysine-specific histone demethylase 1ABRAF35-HDAC complex protein BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunitamine oxidase (flavin containing) domain 2flavin-containing amine oxidase domain-containing protein 2lysine (K)-specific d | |
| Modification date | 20200313 | 20200329 | |
| UniProtAcc | Q8IWW6 | O60341 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000492028, ENST00000344936, ENST00000375245, ENST00000375250, ENST00000396144, ENST00000311380, | ENST00000356634, ENST00000400181, ENST00000542151, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 9 X 8 X 7=504 | 3 X 5 X 3=45 |
| # samples | 11 | 5 | |
| ** MAII score | log2(11/504*10)=-2.19592020997526 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(5/45*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: ARHGAP12 [Title/Abstract] AND KDM1A [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ARHGAP12(32106716)-KDM1A(23403721), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | ARHGAP12-KDM1A seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ARHGAP12-KDM1A seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ARHGAP12-KDM1A seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ARHGAP12-KDM1A seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ARHGAP12-KDM1A seems lost the major protein functional domain in Tgene partner, which is a epigenetic factor due to the frame-shifted ORF. ARHGAP12-KDM1A seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. ARHGAP12-KDM1A seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | KDM1A | GO:0033169 | histone H3-K9 demethylation | 16079795|20228790 |
| Tgene | KDM1A | GO:0034644 | cellular response to UV | 24217620 |
| Tgene | KDM1A | GO:0034720 | histone H3-K4 demethylation | 15620353|20228790|24217620 |
| Tgene | KDM1A | GO:0043433 | negative regulation of DNA-binding transcription factor activity | 19497860 |
| Tgene | KDM1A | GO:0045892 | negative regulation of transcription, DNA-templated | 19497860 |
| Tgene | KDM1A | GO:0045944 | positive regulation of transcription by RNA polymerase II | 20833138 |
| Tgene | KDM1A | GO:0051091 | positive regulation of DNA-binding transcription factor activity | 20833138 |
| Fusion gene breakpoints across ARHGAP12 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across KDM1A (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | STAD | TCGA-FP-8209-01A | ARHGAP12 | chr10 | 32106716 | - | KDM1A | chr1 | 23403721 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000311380 | ARHGAP12 | chr10 | 32106716 | - | ENST00000356634 | KDM1A | chr1 | 23403721 | + | 2816 | 1594 | 19 | 2490 | 823 |
| ENST00000311380 | ARHGAP12 | chr10 | 32106716 | - | ENST00000400181 | KDM1A | chr1 | 23403721 | + | 2815 | 1594 | 19 | 2490 | 823 |
| ENST00000311380 | ARHGAP12 | chr10 | 32106716 | - | ENST00000542151 | KDM1A | chr1 | 23403721 | + | 2816 | 1594 | 19 | 2490 | 823 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000311380 | ENST00000356634 | ARHGAP12 | chr10 | 32106716 | - | KDM1A | chr1 | 23403721 | + | 0.000696977 | 0.999303 |
| ENST00000311380 | ENST00000400181 | ARHGAP12 | chr10 | 32106716 | - | KDM1A | chr1 | 23403721 | + | 0.000700047 | 0.9992999 |
| ENST00000311380 | ENST00000542151 | ARHGAP12 | chr10 | 32106716 | - | KDM1A | chr1 | 23403721 | + | 0.000696977 | 0.999303 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >5932_5932_1_ARHGAP12-KDM1A_ARHGAP12_chr10_32106716_ENST00000311380_KDM1A_chr1_23403721_ENST00000356634_length(amino acids)=823AA_BP=525 MKMADRSGKIIPGQVYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDWWQVKPDENSKAFYVPAQYVKEVTRKALMPPVKQVAGLPNN STKIMQSLHLQRSTENVNKLPELSSFGKPSSSVQGTGLIRDANQNFGPSYNQGQTVNLSLDLTHNNGKFNNDSHSPKVSSQNRTRSFGHF PGPEFLDVEKTSFSQEQSCDSAGEGSERIHQDSESGDELSSSSTEQIRATTPPNQGRPDSPVYANLQELKISQSALPPLPGSPAIQINGE WETHKDSSGRCYYYNRGTQERTWKPPRWTRDASISKGDFQNPGDQEWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSL DRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPSSPKHQDTDQEKYGLLNVTKIAENGKKVRKNWLSSWAVLQGSSLLFTK TQGSSTSWFGSNQSKPEFTVDLKGATIEMASKDKSSKKNVFELKTRQGTELLIQSDNDTVINDWFKVLSSTINNQDDDFEFTGSHLTVRN GYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNL NKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVS RWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQ -------------------------------------------------------------- >5932_5932_2_ARHGAP12-KDM1A_ARHGAP12_chr10_32106716_ENST00000311380_KDM1A_chr1_23403721_ENST00000400181_length(amino acids)=823AA_BP=525 MKMADRSGKIIPGQVYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDWWQVKPDENSKAFYVPAQYVKEVTRKALMPPVKQVAGLPNN STKIMQSLHLQRSTENVNKLPELSSFGKPSSSVQGTGLIRDANQNFGPSYNQGQTVNLSLDLTHNNGKFNNDSHSPKVSSQNRTRSFGHF PGPEFLDVEKTSFSQEQSCDSAGEGSERIHQDSESGDELSSSSTEQIRATTPPNQGRPDSPVYANLQELKISQSALPPLPGSPAIQINGE WETHKDSSGRCYYYNRGTQERTWKPPRWTRDASISKGDFQNPGDQEWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSL DRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPSSPKHQDTDQEKYGLLNVTKIAENGKKVRKNWLSSWAVLQGSSLLFTK TQGSSTSWFGSNQSKPEFTVDLKGATIEMASKDKSSKKNVFELKTRQGTELLIQSDNDTVINDWFKVLSSTINNQDDDFEFTGSHLTVRN GYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNL NKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVS RWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQ -------------------------------------------------------------- >5932_5932_3_ARHGAP12-KDM1A_ARHGAP12_chr10_32106716_ENST00000311380_KDM1A_chr1_23403721_ENST00000542151_length(amino acids)=823AA_BP=525 MKMADRSGKIIPGQVYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDWWQVKPDENSKAFYVPAQYVKEVTRKALMPPVKQVAGLPNN STKIMQSLHLQRSTENVNKLPELSSFGKPSSSVQGTGLIRDANQNFGPSYNQGQTVNLSLDLTHNNGKFNNDSHSPKVSSQNRTRSFGHF PGPEFLDVEKTSFSQEQSCDSAGEGSERIHQDSESGDELSSSSTEQIRATTPPNQGRPDSPVYANLQELKISQSALPPLPGSPAIQINGE WETHKDSSGRCYYYNRGTQERTWKPPRWTRDASISKGDFQNPGDQEWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSL DRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPSSPKHQDTDQEKYGLLNVTKIAENGKKVRKNWLSSWAVLQGSSLLFTK TQGSSTSWFGSNQSKPEFTVDLKGATIEMASKDKSSKKNVFELKTRQGTELLIQSDNDTVINDWFKVLSSTINNQDDDFEFTGSHLTVRN GYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNL NKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVS RWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQ -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr10:32106716/chr1:23403721) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| ARHGAP12 | KDM1A |
| FUNCTION: GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. {ECO:0000250}. | FUNCTION: Histone demethylase that can demethylate both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context (PubMed:15620353, PubMed:15811342, PubMed:16140033, PubMed:16079794, PubMed:16079795, PubMed:16223729). Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed (PubMed:15620353, PubMed:15811342, PubMed:16079794, PubMed:21300290). Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me (PubMed:15620353, PubMed:20389281, PubMed:21300290, PubMed:23721412). May play a role in the repression of neuronal genes. Alone, it is unable to demethylate H3K4me on nucleosomes and requires the presence of RCOR1/CoREST to achieve such activity (PubMed:16140033, PubMed:16079794, PubMed:16885027, PubMed:21300290, PubMed:23721412). Also acts as a coactivator of androgen receptor (AR)-dependent transcription, by being recruited to AR target genes and mediating demethylation of H3K9me, a specific tag for epigenetic transcriptional repression. The presence of PRKCB in AR-containing complexes, which mediates phosphorylation of 'Thr-6' of histone H3 (H3T6ph), a specific tag that prevents demethylation H3K4me, prevents H3K4me demethylase activity of KDM1A (PubMed:16079795). Demethylates di-methylated 'Lys-370' of p53/TP53 which prevents interaction of p53/TP53 with TP53BP1 and represses p53/TP53-mediated transcriptional activation. Demethylates and stabilizes the DNA methylase DNMT1. Required for gastrulation during embryogenesis. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Effector of SNAI1-mediated transcription repression of E-cadherin/CDH1, CDN7 and KRT8. Required for the maintenance of the silenced state of the SNAI1 target genes E-cadherin/CDH1 and CDN7 (PubMed:20389281). {ECO:0000269|PubMed:12032298, ECO:0000269|PubMed:15620353, ECO:0000269|PubMed:15811342, ECO:0000269|PubMed:16079794, ECO:0000269|PubMed:16079795, ECO:0000269|PubMed:16140033, ECO:0000269|PubMed:16223729, ECO:0000269|PubMed:16885027, ECO:0000269|PubMed:16956976, ECO:0000269|PubMed:17805299, ECO:0000269|PubMed:20228790, ECO:0000269|PubMed:20389281, ECO:0000269|PubMed:20562920, ECO:0000269|PubMed:21300290, ECO:0000269|PubMed:23721412}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000311380 | - | 9 | 16 | 12_74 | 525.0 | 795.0 | Domain | SH3 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000311380 | - | 9 | 16 | 265_298 | 525.0 | 795.0 | Domain | WW 1 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000311380 | - | 9 | 16 | 358_391 | 525.0 | 795.0 | Domain | WW 2 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000344936 | - | 13 | 20 | 12_74 | 577.0 | 847.0 | Domain | SH3 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000344936 | - | 13 | 20 | 265_298 | 577.0 | 847.0 | Domain | WW 1 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000344936 | - | 13 | 20 | 358_391 | 577.0 | 847.0 | Domain | WW 2 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000344936 | - | 13 | 20 | 463_575 | 577.0 | 847.0 | Domain | PH |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000375245 | - | 11 | 18 | 12_74 | 525.0 | 795.0 | Domain | SH3 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000375245 | - | 11 | 18 | 265_298 | 525.0 | 795.0 | Domain | WW 1 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000375245 | - | 11 | 18 | 358_391 | 525.0 | 795.0 | Domain | WW 2 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000375250 | - | 11 | 18 | 12_74 | 547.0 | 817.0 | Domain | SH3 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000375250 | - | 11 | 18 | 265_298 | 547.0 | 817.0 | Domain | WW 1 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000375250 | - | 11 | 18 | 358_391 | 547.0 | 817.0 | Domain | WW 2 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000396144 | - | 12 | 19 | 12_74 | 572.0 | 842.0 | Domain | SH3 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000396144 | - | 12 | 19 | 265_298 | 572.0 | 842.0 | Domain | WW 1 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000396144 | - | 12 | 19 | 358_391 | 572.0 | 842.0 | Domain | WW 2 |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000396144 | - | 12 | 19 | 463_575 | 572.0 | 842.0 | Domain | PH |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000356634 | 12 | 19 | 810_811 | 554.0 | 853.0 | Nucleotide binding | FAD | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000400181 | 14 | 21 | 810_811 | 578.0 | 877.0 | Nucleotide binding | FAD |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000311380 | - | 9 | 16 | 463_575 | 525.0 | 795.0 | Domain | PH |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000311380 | - | 9 | 16 | 656_844 | 525.0 | 795.0 | Domain | Rho-GAP |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000344936 | - | 13 | 20 | 656_844 | 577.0 | 847.0 | Domain | Rho-GAP |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000375245 | - | 11 | 18 | 463_575 | 525.0 | 795.0 | Domain | PH |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000375245 | - | 11 | 18 | 656_844 | 525.0 | 795.0 | Domain | Rho-GAP |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000375250 | - | 11 | 18 | 463_575 | 547.0 | 817.0 | Domain | PH |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000375250 | - | 11 | 18 | 656_844 | 547.0 | 817.0 | Domain | Rho-GAP |
| Hgene | ARHGAP12 | chr10:32106716 | chr1:23403721 | ENST00000396144 | - | 12 | 19 | 656_844 | 572.0 | 842.0 | Domain | Rho-GAP |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000356634 | 12 | 19 | 110_151 | 554.0 | 853.0 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000356634 | 12 | 19 | 428_514 | 554.0 | 853.0 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000400181 | 14 | 21 | 110_151 | 578.0 | 877.0 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000400181 | 14 | 21 | 428_514 | 578.0 | 877.0 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000356634 | 12 | 19 | 152_156 | 554.0 | 853.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000356634 | 12 | 19 | 7_42 | 554.0 | 853.0 | Compositional bias | Note=Ala-rich | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000400181 | 14 | 21 | 152_156 | 578.0 | 877.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000400181 | 14 | 21 | 7_42 | 578.0 | 877.0 | Compositional bias | Note=Ala-rich | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000356634 | 12 | 19 | 174_273 | 554.0 | 853.0 | Domain | SWIRM | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000400181 | 14 | 21 | 174_273 | 578.0 | 877.0 | Domain | SWIRM | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000356634 | 12 | 19 | 332_333 | 554.0 | 853.0 | Nucleotide binding | FAD | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000400181 | 14 | 21 | 332_333 | 578.0 | 877.0 | Nucleotide binding | FAD | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000356634 | 12 | 19 | 300_852 | 554.0 | 853.0 | Region | Note=Demethylase activity | |
| Tgene | KDM1A | chr10:32106716 | chr1:23403721 | ENST00000400181 | 14 | 21 | 300_852 | 578.0 | 877.0 | Region | Note=Demethylase activity |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| ARHGAP12 | |
| KDM1A |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to ARHGAP12-KDM1A |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ARHGAP12-KDM1A |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies