| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:OGT-NONO |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: OGT-NONO | FusionPDB ID: 61435 | FusionGDB2.0 ID: 61435 | Hgene | Tgene | Gene symbol | OGT | NONO | Gene ID | 8473 | 4841 |
| Gene name | O-linked N-acetylglucosamine (GlcNAc) transferase | non-POU domain containing octamer binding | |
| Synonyms | HINCUT-1|HRNT1|MRX106|O-GLCNAC|OGT1 | MRXS34|NMT55|NRB54|P54|P54NRB|PPP1R114 | |
| Cytomap | Xq13.1 | Xq13.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunitO-GlcNAc transferase p110 subunitO-GlcNAc transferase subunit p110O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminy | non-POU domain-containing octamer-binding protein54 kDa nuclear RNA- and DNA-binding protein55 kDa nuclear proteinDNA-binding p52/p100 complex, 52 kDa subunitnon-POU domain-containing octamer (ATGCAAAT) binding proteinp54(nrb)protein phosphatase 1, | |
| Modification date | 20200327 | 20200313 | |
| UniProtAcc | . | Q15233 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000373701, ENST00000373719, ENST00000498566, | ENST00000490044, ENST00000276079, ENST00000373841, ENST00000373856, ENST00000535149, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 9 X 9 X 4=324 | 8 X 8 X 3=192 |
| # samples | 10 | 8 | |
| ** MAII score | log2(10/324*10)=-1.6959938131099 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(8/192*10)=-1.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: OGT [Title/Abstract] AND NONO [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | OGT(70774442)-NONO(70516415), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | OGT-NONO seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. OGT-NONO seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. OGT-NONO seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. OGT-NONO seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | OGT | GO:0006110 | regulation of glycolytic process | 22923583 |
| Hgene | OGT | GO:0006493 | protein O-linked glycosylation | 21240259|21285374|22923583|23222540|23352454|24474760 |
| Hgene | OGT | GO:0006915 | apoptotic process | 20824293 |
| Hgene | OGT | GO:0032868 | response to insulin | 18288188 |
| Hgene | OGT | GO:0035020 | regulation of Rac protein signal transduction | 18288188 |
| Hgene | OGT | GO:0043981 | histone H4-K5 acetylation | 20018852 |
| Hgene | OGT | GO:0043982 | histone H4-K8 acetylation | 20018852 |
| Hgene | OGT | GO:0043984 | histone H4-K16 acetylation | 20018852 |
| Hgene | OGT | GO:0045862 | positive regulation of proteolysis | 21285374 |
| Hgene | OGT | GO:0045944 | positive regulation of transcription by RNA polymerase II | 23222540|23353889 |
| Hgene | OGT | GO:0046626 | regulation of insulin receptor signaling pathway | 18288188 |
| Hgene | OGT | GO:0048015 | phosphatidylinositol-mediated signaling | 18288188 |
| Tgene | NONO | GO:0002218 | activation of innate immune response | 28712728 |
| Tgene | NONO | GO:1903377 | negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway | 15790595 |
| Fusion gene breakpoints across OGT (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across NONO (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | LIHC | TCGA-FV-A496-01A | OGT | chrX | 70774442 | + | NONO | chrX | 70516415 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000373719 | OGT | chrX | 70774442 | + | ENST00000535149 | NONO | chrX | 70516415 | + | 2801 | 945 | 67 | 1710 | 547 |
| ENST00000373719 | OGT | chrX | 70774442 | + | ENST00000276079 | NONO | chrX | 70516415 | + | 2803 | 945 | 67 | 1710 | 547 |
| ENST00000373719 | OGT | chrX | 70774442 | + | ENST00000373856 | NONO | chrX | 70516415 | + | 1904 | 945 | 67 | 1710 | 547 |
| ENST00000373719 | OGT | chrX | 70774442 | + | ENST00000373841 | NONO | chrX | 70516415 | + | 2803 | 945 | 67 | 1710 | 547 |
| ENST00000373701 | OGT | chrX | 70774442 | + | ENST00000535149 | NONO | chrX | 70516415 | + | 2731 | 875 | 27 | 1640 | 537 |
| ENST00000373701 | OGT | chrX | 70774442 | + | ENST00000276079 | NONO | chrX | 70516415 | + | 2733 | 875 | 27 | 1640 | 537 |
| ENST00000373701 | OGT | chrX | 70774442 | + | ENST00000373856 | NONO | chrX | 70516415 | + | 1834 | 875 | 27 | 1640 | 537 |
| ENST00000373701 | OGT | chrX | 70774442 | + | ENST00000373841 | NONO | chrX | 70516415 | + | 2733 | 875 | 27 | 1640 | 537 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000373719 | ENST00000535149 | OGT | chrX | 70774442 | + | NONO | chrX | 70516415 | + | 0.002445235 | 0.99755484 |
| ENST00000373719 | ENST00000276079 | OGT | chrX | 70774442 | + | NONO | chrX | 70516415 | + | 0.002416017 | 0.997584 |
| ENST00000373719 | ENST00000373856 | OGT | chrX | 70774442 | + | NONO | chrX | 70516415 | + | 0.00552883 | 0.9944712 |
| ENST00000373719 | ENST00000373841 | OGT | chrX | 70774442 | + | NONO | chrX | 70516415 | + | 0.002416017 | 0.997584 |
| ENST00000373701 | ENST00000535149 | OGT | chrX | 70774442 | + | NONO | chrX | 70516415 | + | 0.003730317 | 0.9962697 |
| ENST00000373701 | ENST00000276079 | OGT | chrX | 70774442 | + | NONO | chrX | 70516415 | + | 0.003680586 | 0.9963194 |
| ENST00000373701 | ENST00000373856 | OGT | chrX | 70774442 | + | NONO | chrX | 70516415 | + | 0.009079591 | 0.9909204 |
| ENST00000373701 | ENST00000373841 | OGT | chrX | 70774442 | + | NONO | chrX | 70516415 | + | 0.003680586 | 0.9963194 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >61435_61435_1_OGT-NONO_OGT_chrX_70774442_ENST00000373701_NONO_chrX_70516415_ENST00000276079_length(amino acids)=537AA_BP=282 MKPVTAAAAQALQSIATAAALVLLPPNTFLLVVAAAGPITSFLLSLEKLQMASSVGNVADSTGLAELAHREYQAGDFEAAERHCMQLWRQ EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDME GAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYIN LGNVLKEARIFDRFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEARE KLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRM -------------------------------------------------------------- >61435_61435_2_OGT-NONO_OGT_chrX_70774442_ENST00000373701_NONO_chrX_70516415_ENST00000373841_length(amino acids)=537AA_BP=282 MKPVTAAAAQALQSIATAAALVLLPPNTFLLVVAAAGPITSFLLSLEKLQMASSVGNVADSTGLAELAHREYQAGDFEAAERHCMQLWRQ EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDME GAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYIN LGNVLKEARIFDRFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEARE KLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRM -------------------------------------------------------------- >61435_61435_3_OGT-NONO_OGT_chrX_70774442_ENST00000373701_NONO_chrX_70516415_ENST00000373856_length(amino acids)=537AA_BP=282 MKPVTAAAAQALQSIATAAALVLLPPNTFLLVVAAAGPITSFLLSLEKLQMASSVGNVADSTGLAELAHREYQAGDFEAAERHCMQLWRQ EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDME GAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYIN LGNVLKEARIFDRFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEARE KLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRM -------------------------------------------------------------- >61435_61435_4_OGT-NONO_OGT_chrX_70774442_ENST00000373701_NONO_chrX_70516415_ENST00000535149_length(amino acids)=537AA_BP=282 MKPVTAAAAQALQSIATAAALVLLPPNTFLLVVAAAGPITSFLLSLEKLQMASSVGNVADSTGLAELAHREYQAGDFEAAERHCMQLWRQ EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDME GAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYIN LGNVLKEARIFDRFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEARE KLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRM -------------------------------------------------------------- >61435_61435_5_OGT-NONO_OGT_chrX_70774442_ENST00000373719_NONO_chrX_70516415_ENST00000276079_length(amino acids)=547AA_BP=292 MKPVTAAAAQALQSIATAAALVLLPPNTFLLVVAAAGPITSFLLSLEKLQMASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAA ERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLA AALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL DPNFLDAYINLGNVLKEARIFDRFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQ VDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTF PDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFA -------------------------------------------------------------- >61435_61435_6_OGT-NONO_OGT_chrX_70774442_ENST00000373719_NONO_chrX_70516415_ENST00000373841_length(amino acids)=547AA_BP=292 MKPVTAAAAQALQSIATAAALVLLPPNTFLLVVAAAGPITSFLLSLEKLQMASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAA ERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLA AALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL DPNFLDAYINLGNVLKEARIFDRFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQ VDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTF PDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFA -------------------------------------------------------------- >61435_61435_7_OGT-NONO_OGT_chrX_70774442_ENST00000373719_NONO_chrX_70516415_ENST00000373856_length(amino acids)=547AA_BP=292 MKPVTAAAAQALQSIATAAALVLLPPNTFLLVVAAAGPITSFLLSLEKLQMASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAA ERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLA AALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL DPNFLDAYINLGNVLKEARIFDRFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQ VDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTF PDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFA -------------------------------------------------------------- >61435_61435_8_OGT-NONO_OGT_chrX_70774442_ENST00000373719_NONO_chrX_70516415_ENST00000535149_length(amino acids)=547AA_BP=292 MKPVTAAAAQALQSIATAAALVLLPPNTFLLVVAAAGPITSFLLSLEKLQMASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAA ERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLA AALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL DPNFLDAYINLGNVLKEARIFDRFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQ VDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTF PDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFA -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chrX:70774442/chrX:70516415) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| . | NONO |
| FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: DNA- and RNA binding protein, involved in several nuclear processes. Binds the conventional octamer sequence in double-stranded DNA. Also binds single-stranded DNA and RNA at a site independent of the duplex site. Involved in pre-mRNA splicing, probably as a heterodimer with SFPQ. Interacts with U5 snRNA, probably by binding to a purine-rich sequence located on the 3' side of U5 snRNA stem 1b. Together with PSPC1, required for the formation of nuclear paraspeckles. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs. The SFPQ-NONO heteromer may be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1. The SFPQ-NONO heteromer may be involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. In vitro, the complex strongly stimulates DNA end joining, binds directly to the DNA substrates and cooperates with the Ku70/G22P1-Ku80/XRCC5 (Ku) dimer to establish a functional preligation complex. NONO is involved in transcriptional regulation. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional activity. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Important for the functional organization of GABAergic synapses. Plays a specific and important role in the regulation of synaptic RNAs and GPHN/gephyrin scaffold structure, through the regulation of GABRA2 transcript. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway (PubMed:28712728). {ECO:0000250|UniProtKB:Q99K48, ECO:0000269|PubMed:10858305, ECO:0000269|PubMed:11525732, ECO:0000269|PubMed:11897684, ECO:0000269|PubMed:15590677, ECO:0000269|PubMed:22416126, ECO:0000269|PubMed:26571461, ECO:0000269|PubMed:28712728}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 123_156 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 3 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 157_190 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 4 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 191_224 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 5 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 21_54 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 1 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 89_122 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 2 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 123_156 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 3 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 157_190 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 4 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 191_224 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 5 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 21_54 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 1 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 89_122 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 2 |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000276079 | 4 | 12 | 268_372 | 216.66666666666666 | 472.0 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373841 | 3 | 11 | 268_372 | 216.66666666666666 | 472.0 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373856 | 5 | 13 | 268_372 | 216.66666666666666 | 472.0 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000535149 | 2 | 10 | 268_372 | 127.66666666666667 | 383.0 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000276079 | 4 | 12 | 348_351 | 216.66666666666666 | 472.0 | Compositional bias | Note=Poly-Arg | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373841 | 3 | 11 | 348_351 | 216.66666666666666 | 472.0 | Compositional bias | Note=Poly-Arg | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373856 | 5 | 13 | 348_351 | 216.66666666666666 | 472.0 | Compositional bias | Note=Poly-Arg | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000535149 | 2 | 10 | 348_351 | 127.66666666666667 | 383.0 | Compositional bias | Note=Poly-Arg | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000535149 | 2 | 10 | 148_229 | 127.66666666666667 | 383.0 | Domain | RRM 2 |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 487_503 | 232.66666666666666 | 1037.0 | Motif | Nuclear localization signal |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 487_503 | 242.66666666666666 | 1047.0 | Motif | Nuclear localization signal |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 906_908 | 232.66666666666666 | 1037.0 | Nucleotide binding | UDP |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 911_914 | 232.66666666666666 | 1037.0 | Nucleotide binding | UDP |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 930_932 | 232.66666666666666 | 1037.0 | Nucleotide binding | UDP |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 906_908 | 242.66666666666666 | 1047.0 | Nucleotide binding | UDP |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 911_914 | 242.66666666666666 | 1047.0 | Nucleotide binding | UDP |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 930_932 | 242.66666666666666 | 1047.0 | Nucleotide binding | UDP |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 991_1010 | 232.66666666666666 | 1037.0 | Region | Note=Required for phosphatidylinositol 3%2C4%2C5-triphosphate binding |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 991_1010 | 242.66666666666666 | 1047.0 | Region | Note=Required for phosphatidylinositol 3%2C4%2C5-triphosphate binding |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 225_258 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 6 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 259_292 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 7 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 293_326 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 8 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 327_360 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 9 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 361_394 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 10 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 395_428 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 11 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 429_462 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 12 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373701 | + | 6 | 22 | 463_473 | 232.66666666666666 | 1037.0 | Repeat | Note=TPR 13%3B truncated |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 225_258 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 6 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 259_292 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 7 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 293_326 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 8 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 327_360 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 9 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 361_394 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 10 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 395_428 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 11 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 429_462 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 12 |
| Hgene | OGT | chrX:70774442 | chrX:70516415 | ENST00000373719 | + | 6 | 22 | 463_473 | 242.66666666666666 | 1047.0 | Repeat | Note=TPR 13%3B truncated |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000276079 | 4 | 12 | 30_35 | 216.66666666666666 | 472.0 | Compositional bias | Note=Poly-Gln | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000276079 | 4 | 12 | 36_42 | 216.66666666666666 | 472.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373841 | 3 | 11 | 30_35 | 216.66666666666666 | 472.0 | Compositional bias | Note=Poly-Gln | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373841 | 3 | 11 | 36_42 | 216.66666666666666 | 472.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373856 | 5 | 13 | 30_35 | 216.66666666666666 | 472.0 | Compositional bias | Note=Poly-Gln | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373856 | 5 | 13 | 36_42 | 216.66666666666666 | 472.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000535149 | 2 | 10 | 30_35 | 127.66666666666667 | 383.0 | Compositional bias | Note=Poly-Gln | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000535149 | 2 | 10 | 36_42 | 127.66666666666667 | 383.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000276079 | 4 | 12 | 148_229 | 216.66666666666666 | 472.0 | Domain | RRM 2 | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000276079 | 4 | 12 | 74_141 | 216.66666666666666 | 472.0 | Domain | RRM 1 | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373841 | 3 | 11 | 148_229 | 216.66666666666666 | 472.0 | Domain | RRM 2 | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373841 | 3 | 11 | 74_141 | 216.66666666666666 | 472.0 | Domain | RRM 1 | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373856 | 5 | 13 | 148_229 | 216.66666666666666 | 472.0 | Domain | RRM 2 | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373856 | 5 | 13 | 74_141 | 216.66666666666666 | 472.0 | Domain | RRM 1 | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000535149 | 2 | 10 | 74_141 | 127.66666666666667 | 383.0 | Domain | RRM 1 | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000276079 | 4 | 12 | 54_373 | 216.66666666666666 | 472.0 | Region | Note=DBHS | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373841 | 3 | 11 | 54_373 | 216.66666666666666 | 472.0 | Region | Note=DBHS | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000373856 | 5 | 13 | 54_373 | 216.66666666666666 | 472.0 | Region | Note=DBHS | |
| Tgene | NONO | chrX:70774442 | chrX:70516415 | ENST00000535149 | 2 | 10 | 54_373 | 127.66666666666667 | 383.0 | Region | Note=DBHS |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| OGT | |
| NONO |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to OGT-NONO |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to OGT-NONO |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies