UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:PIK3CB-COPB2 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: PIK3CB-COPB2 | FusionPDB ID: 65370 | FusionGDB2.0 ID: 65370 | Hgene | Tgene | Gene symbol | PIK3CB | COPB2 | Gene ID | 5291 | 9276 |
Gene name | phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta | COPI coat complex subunit beta 2 | |
Synonyms | P110BETA|PI3K|PI3KBETA|PIK3C1 | MCPH19|beta'-COP | |
Cytomap | 3q22.3 | 3q23 | |
Type of gene | protein-coding | protein-coding | |
Description | phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoformPI3-kinase p110 subunit betaPI3-kinase subunit betaPI3K-betaPtdIns-3-kinase p110phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit betaphosphoinositid | coatomer subunit beta'beta'-coat proteinbetaprime-COPcoatomer binding complex, beta prime subunitcoatomer protein complex subunit beta 2coatomer protein complex subunit beta primecoatomer protein complex, subunit beta 2 (beta prime)p102 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | . | P35606 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000289153, ENST00000477593, ENST00000544716, | ENST00000507777, ENST00000510491, ENST00000333188, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 15 X 13 X 11=2145 | 7 X 6 X 2=84 |
# samples | 17 | 7 | |
** MAII score | log2(17/2145*10)=-3.65737099624921 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(7/84*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: PIK3CB [Title/Abstract] AND COPB2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | PIK3CB(138478015)-COPB2(139102277), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | PIK3CB-COPB2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. PIK3CB-COPB2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. PIK3CB-COPB2 seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. PIK3CB-COPB2 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. PIK3CB-COPB2 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. PIK3CB-COPB2 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | PIK3CB | GO:0016310 | phosphorylation | 25327288 |
Tgene | COPB2 | GO:0006891 | intra-Golgi vesicle-mediated transport | 8335000 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-EW-A3E8-01B | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000289153 | PIK3CB | chr3 | 138478015 | - | ENST00000333188 | COPB2 | chr3 | 139102277 | - | 3346 | 171 | 0 | 2888 | 962 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000289153 | ENST00000333188 | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - | 0.000670865 | 0.9993292 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >65370_65370_1_PIK3CB-COPB2_PIK3CB_chr3_138478015_ENST00000289153_COPB2_chr3_139102277_ENST00000333188_length(amino acids)=962AA_BP=57 MCFSFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASL YNGSVCVWNHETQTLVKTFEVCDLPVRAAKFVARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDDMLIK LWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIW DYQNKTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIWHSSTYRLESTLNYGMERVWCVASLRGSNNVALGYDEGSIIVKLGREEP AMSMDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGSCEIYPQTIQHNPNGRFVVVCGDGEYIIYTAMALRNKSFGSAQEF AWAHDSSEYAIRESNSIVKIFKNFKEKKSFKPDFGAESIYGGFLLGVRSVNGLAFYDWDNTELIRRIEIQPKHIFWSDSGELVCIATEES FFILKYLSEKVLAAQETHEGVTEDGIEDAFEVLGEIQEIVKTGLWVGDCFIYTSSVNRLNYYVGGEIVTIAHLDRTMYLLGYIPKDNRLY LGDKELNIISYSLLVSVLEYQTAVMRRDFSMADKVLPTIPKEQRTRVAHFLEKQGFKQQALTVSTDPEHRFELALQLGELKIAYQLAVEA ESEQKWKQLAELAISKCQFGLAQECLHHAQDYGGLLLLATASGNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEA AFLARTYLPSQVSRVVKLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFVVEEWVKETHADLWPAKQYPLVTPNEERNVMEEGKDFQP -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr3:138478015/chr3:139102277) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | COPB2 |
FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity). {ECO:0000250}.; FUNCTION: This coatomer complex protein, essential for Golgi budding and vesicular trafficking, is a selective binding protein (RACK) for protein kinase C, epsilon type. It binds to Golgi membranes in a GTP-dependent manner (By similarity). {ECO:0000250}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 866_891 | 1.0 | 907.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 13_52 | 1.0 | 907.0 | Repeat | Note=WD 1 | |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 140_180 | 1.0 | 907.0 | Repeat | Note=WD 4 | |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 183_224 | 1.0 | 907.0 | Repeat | Note=WD 5 | |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 227_266 | 1.0 | 907.0 | Repeat | Note=WD 6 | |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 55_94 | 1.0 | 907.0 | Repeat | Note=WD 2 | |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 97_136 | 1.0 | 907.0 | Repeat | Note=WD 3 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000289153 | - | 1 | 22 | 194_285 | 57.0 | 1071.0 | Domain | PI3K-RBD |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000289153 | - | 1 | 22 | 26_115 | 57.0 | 1071.0 | Domain | PI3K-ABD |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000289153 | - | 1 | 22 | 327_496 | 57.0 | 1071.0 | Domain | C2 PI3K-type |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000289153 | - | 1 | 22 | 524_701 | 57.0 | 1071.0 | Domain | PIK helical |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000289153 | - | 1 | 22 | 800_1067 | 57.0 | 1071.0 | Domain | PI3K/PI4K |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000477593 | - | 2 | 23 | 194_285 | 57.0 | 1071.0 | Domain | PI3K-RBD |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000477593 | - | 2 | 23 | 26_115 | 57.0 | 1071.0 | Domain | PI3K-ABD |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000477593 | - | 2 | 23 | 327_496 | 57.0 | 1071.0 | Domain | C2 PI3K-type |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000477593 | - | 2 | 23 | 524_701 | 57.0 | 1071.0 | Domain | PIK helical |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000477593 | - | 2 | 23 | 800_1067 | 57.0 | 1071.0 | Domain | PI3K/PI4K |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000289153 | - | 1 | 22 | 410_418 | 57.0 | 1071.0 | Motif | Note=Nuclear localization signal |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000477593 | - | 2 | 23 | 410_418 | 57.0 | 1071.0 | Motif | Note=Nuclear localization signal |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
PIK3CB | |
COPB2 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to PIK3CB-COPB2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to PIK3CB-COPB2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |