| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:TRIM32-DDX21 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: TRIM32-DDX21 | FusionPDB ID: 94068 | FusionGDB2.0 ID: 94068 | Hgene | Tgene | Gene symbol | TRIM32 | DDX21 | Gene ID | 22954 | 54606 |
| Gene name | tripartite motif containing 32 | DEAD-box helicase 56 | |
| Synonyms | BBS11|HT2A|LGMD2H|LGMDR8|TATIP | DDX21|DDX26|NOH61 | |
| Cytomap | 9q33.1 | 7p13 | |
| Type of gene | protein-coding | protein-coding | |
| Description | E3 ubiquitin-protein ligase TRIM3272 kDa Tat-interacting proteinRING-type E3 ubiquitin transferase TRIM32TAT-interactive protein, 72-KDtripartite motif-containing protein 32zinc-finger protein HT2A | probable ATP-dependent RNA helicase DDX5661-kd nucleolar helicaseATP-dependent 61 kDa nucleolar RNA helicaseDEAD (Asp-Glu-Ala-Asp) box helicase 56DEAD (Asp-Glu-Ala-Asp) box polypeptide 56DEAD box protein 21DEAD box protein 56DEAD-box RNA helicasen | |
| Modification date | 20200327 | 20200313 | |
| UniProtAcc | . | Q9NR30 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000450136, ENST00000373983, | ENST00000354185, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 2 X 2 X 2=8 | 36 X 11 X 14=5544 |
| # samples | 3 | 37 | |
| ** MAII score | log2(3/8*10)=1.90689059560852 | log2(37/5544*10)=-3.9053300816209 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: TRIM32 [Title/Abstract] AND DDX21 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | TRIM32(119461323)-DDX21(70738619), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | TRIM32-DDX21 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. TRIM32-DDX21 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. TRIM32-DDX21 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. TRIM32-DDX21 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. TRIM32-DDX21 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. TRIM32-DDX21 seems lost the major protein functional domain in Tgene partner, which is a epigenetic factor due to the frame-shifted ORF. TRIM32-DDX21 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | TRIM32 | GO:0000209 | protein polyubiquitination | 18632609 |
| Hgene | TRIM32 | GO:0016567 | protein ubiquitination | 16816390 |
| Hgene | TRIM32 | GO:0030307 | positive regulation of cell growth | 18632609 |
| Hgene | TRIM32 | GO:0030335 | positive regulation of cell migration | 18632609 |
| Hgene | TRIM32 | GO:0032897 | negative regulation of viral transcription | 18248090 |
| Hgene | TRIM32 | GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB signaling | 23077300 |
| Hgene | TRIM32 | GO:0045087 | innate immune response | 18248090 |
| Hgene | TRIM32 | GO:0045787 | positive regulation of cell cycle | 18632609 |
| Hgene | TRIM32 | GO:0045862 | positive regulation of proteolysis | 18632609 |
| Hgene | TRIM32 | GO:0051091 | positive regulation of DNA-binding transcription factor activity | 23077300 |
| Hgene | TRIM32 | GO:0051092 | positive regulation of NF-kappaB transcription factor activity | 23077300 |
| Hgene | TRIM32 | GO:1902187 | negative regulation of viral release from host cell | 18248090 |
| Hgene | TRIM32 | GO:1902230 | negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage | 18632609 |
| Fusion gene breakpoints across TRIM32 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across DDX21 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChiTaRS5.0 | N/A | CN278368 | TRIM32 | chr9 | 119461323 | + | DDX21 | chr10 | 70738619 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000373983 | TRIM32 | chr9 | 119461323 | + | ENST00000354185 | DDX21 | chr10 | 70738619 | + | 4997 | 2308 | 55 | 711 | 218 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000373983 | ENST00000354185 | TRIM32 | chr9 | 119461323 | + | DDX21 | chr10 | 70738619 | + | 0.001908144 | 0.9980919 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >94068_94068_1_TRIM32-DDX21_TRIM32_chr9_119461323_ENST00000373983_DDX21_chr10_70738619_ENST00000354185_length(amino acids)=218AA_BP= MNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEG TVYFTQGLGLNLENRQNEHHLEGGFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREG -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:119461323/chr10:70738619) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| . | DDX21 |
| FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: RNA helicase that acts as a sensor of the transcriptional status of both RNA polymerase (Pol) I and II: promotes ribosomal RNA (rRNA) processing and transcription from polymerase II (Pol II) (PubMed:25470060, PubMed:28790157). Binds various RNAs, such as rRNAs, snoRNAs, 7SK and, at lower extent, mRNAs (PubMed:25470060). In the nucleolus, localizes to rDNA locus, where it directly binds rRNAs and snoRNAs, and promotes rRNA transcription, processing and modification. Required for rRNA 2'-O-methylation, possibly by promoting the recruitment of late-acting snoRNAs SNORD56 and SNORD58 with pre-ribosomal complexes (PubMed:25470060, PubMed:25477391). In the nucleoplasm, binds 7SK RNA and is recruited to the promoters of Pol II-transcribed genes: acts by facilitating the release of P-TEFb from inhibitory 7SK snRNP in a manner that is dependent on its helicase activity, thereby promoting transcription of its target genes (PubMed:25470060). Functions as cofactor for JUN-activated transcription: required for phosphorylation of JUN at 'Ser-77' (PubMed:11823437, PubMed:25260534). Can unwind double-stranded RNA (helicase) and can fold or introduce a secondary structure to a single-stranded RNA (foldase) (PubMed:9461305). Together with SIRT7, required to prevent R-loop-associated DNA damage and transcription-associated genomic instability: deacetylation by SIRT7 activates the helicase activity, thereby overcoming R-loop-mediated stalling of RNA polymerases (PubMed:28790157). Involved in rRNA processing (PubMed:14559904, PubMed:18180292). May bind to specific miRNA hairpins (PubMed:28431233). Component of a multi-helicase-TICAM1 complex that acts as a cytoplasmic sensor of viral double-stranded RNA (dsRNA) and plays a role in the activation of a cascade of antiviral responses including the induction of proinflammatory cytokines via the adapter molecule TICAM1 (By similarity). {ECO:0000250|UniProtKB:Q9JIK5, ECO:0000269|PubMed:11823437, ECO:0000269|PubMed:14559904, ECO:0000269|PubMed:18180292, ECO:0000269|PubMed:25260534, ECO:0000269|PubMed:25470060, ECO:0000269|PubMed:25477391, ECO:0000269|PubMed:28431233, ECO:0000269|PubMed:28790157, ECO:0000269|PubMed:9461305}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | DDX21 | chr9:119461323 | chr10:70738619 | ENST00000354185 | 0 | 15 | 217_396 | 0 | 784.0 | Domain | Helicase ATP-binding | |
| Tgene | DDX21 | chr9:119461323 | chr10:70738619 | ENST00000354185 | 0 | 15 | 429_573 | 0 | 784.0 | Domain | Helicase C-terminal | |
| Tgene | DDX21 | chr9:119461323 | chr10:70738619 | ENST00000354185 | 0 | 15 | 186_214 | 0 | 784.0 | Motif | Q motif | |
| Tgene | DDX21 | chr9:119461323 | chr10:70738619 | ENST00000354185 | 0 | 15 | 339_342 | 0 | 784.0 | Motif | DEAD box | |
| Tgene | DDX21 | chr9:119461323 | chr10:70738619 | ENST00000354185 | 0 | 15 | 230_237 | 0 | 784.0 | Nucleotide binding | ATP | |
| Tgene | DDX21 | chr9:119461323 | chr10:70738619 | ENST00000354185 | 0 | 15 | 724_748 | 0 | 784.0 | Region | Note=3 X 5 AA repeats | |
| Tgene | DDX21 | chr9:119461323 | chr10:70738619 | ENST00000354185 | 0 | 15 | 724_728 | 0 | 784.0 | Repeat | Note=1 | |
| Tgene | DDX21 | chr9:119461323 | chr10:70738619 | ENST00000354185 | 0 | 15 | 734_738 | 0 | 784.0 | Repeat | Note=2 | |
| Tgene | DDX21 | chr9:119461323 | chr10:70738619 | ENST00000354185 | 0 | 15 | 744_748 | 0 | 784.0 | Repeat | Note=3 |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000373983 | + | 1 | 2 | 138_197 | 0 | 654.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000450136 | + | 1 | 2 | 138_197 | 0 | 654.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000373983 | + | 1 | 2 | 2_6 | 0 | 654.0 | Compositional bias | Note=Poly-Ala |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000450136 | + | 1 | 2 | 2_6 | 0 | 654.0 | Compositional bias | Note=Poly-Ala |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000373983 | + | 1 | 2 | 358_401 | 0 | 654.0 | Repeat | Note=NHL 1 |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000373983 | + | 1 | 2 | 415_458 | 0 | 654.0 | Repeat | Note=NHL 2 |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000373983 | + | 1 | 2 | 459_499 | 0 | 654.0 | Repeat | Note=NHL 3 |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000373983 | + | 1 | 2 | 562_605 | 0 | 654.0 | Repeat | Note=NHL 4 |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000373983 | + | 1 | 2 | 606_646 | 0 | 654.0 | Repeat | Note=NHL 5 |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000450136 | + | 1 | 2 | 358_401 | 0 | 654.0 | Repeat | Note=NHL 1 |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000450136 | + | 1 | 2 | 415_458 | 0 | 654.0 | Repeat | Note=NHL 2 |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000450136 | + | 1 | 2 | 459_499 | 0 | 654.0 | Repeat | Note=NHL 3 |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000450136 | + | 1 | 2 | 562_605 | 0 | 654.0 | Repeat | Note=NHL 4 |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000450136 | + | 1 | 2 | 606_646 | 0 | 654.0 | Repeat | Note=NHL 5 |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000373983 | + | 1 | 2 | 103_133 | 0 | 654.0 | Zinc finger | B box-type |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000373983 | + | 1 | 2 | 20_65 | 0 | 654.0 | Zinc finger | RING-type |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000450136 | + | 1 | 2 | 103_133 | 0 | 654.0 | Zinc finger | B box-type |
| Hgene | TRIM32 | chr9:119461323 | chr10:70738619 | ENST00000450136 | + | 1 | 2 | 20_65 | 0 | 654.0 | Zinc finger | RING-type |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| TRIM32 | |
| DDX21 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to TRIM32-DDX21 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to TRIM32-DDX21 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies