|
|||||||
|
Protein:UNC5A |
Protein Summary |
 Gene summary |
| Fusion partner gene information | Gene name: UNC5A | ASpdb.0 ID: 90249 | Gene | Gene symbol | UNC5A | Gene ID | 90249 |
| Gene name | unc-5 netrin receptor A | |
| Synonyms | UNC5H1 | |
| Cytomap | 5q35.2 | |
| Type of gene | protein-coding | |
| Description | netrin receptor UNC5Anetrin receptor Unc5h1protein unc-5 homolog 1protein unc-5 homolog Aunc-5 homolog 1unc-5 homolog Aunc5 (C.elegans homolog) a | |
| Modification date | 20240305 | |
| UniProtAcc | Q6ZN44 | |
| Context (manual curation of fusion genes in ASpdb) | PubMed: UNC5A [Title/Abstract] AND Alternative splicing [Title/Abstract] AND Protein [Title/Abstract] | |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
Top |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q6ZN44-1 | Q6ZN44-1_4v2a_A.pdb | 4V2A | X-ray | 2.4 | A | 43 | Q6ZN44-1294 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q6ZN44 | UNC5A | Q6ZN44-1 | Q6ZN44-2 | 842 | 301 | 296 | 301 | Substitution | TASGPE | SESSLP | 296 | 301 |
| Q6ZN44 | UNC5A | Q6ZN44-1 | Q6ZN44-2 | 842 | 301 | 302 | 842 | Deletion | none | none | 301 | 301 |
| Q6ZN44 | UNC5A | Q6ZN44-1 | Q6ZN44-3 | 842 | 802 | 1 | 97 | Substitution | MAVRPGLWPALLGIVLAAWLRGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKPVLLVCKAVPATQIFFKCNGEWVRQVDHVIERSTDGSS | MAGTSERSLISSISQPKAIECFEVKKKAFLTHGRYHGSGATPPKTKDPKPETFCGQT | 1 | 57 |
| Multiple sequence alignment of our canonical and alternatively spliced UNC5A |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of UNC5A |
| UniProt-id | ENSG | ENST | ENSP |
| Q6ZN44-1 | ENSG00000113763.12 | ENST00000329542.9 | ENSP00000332737.4 |
* Matched gene isoform IDs with RefSeq IDs
| UniProt-id | NM ID | NP ID |
| Q6ZN44-1 | NM_133369.2 | NP_588610.2 |
| Amino acid sequences of our canonical and alternatively spliced UNC5A |
| accession_id | Protein sequence |
| Q6ZN44-1 | MAVRPGLWPALLGIVLAAWLRGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKPVLLVCKAVPATQIFFKCNGEWVRQVDHVIE RSTDGSSGLPTMEVRINVSRQQVEKVFGLEEYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAE VEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVYVDGSWSPWSKWSACGLDCTHWRSRECSDPA PRNGGEECQGTDLDTRNCTSDLCVHTASGPEDVALYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADN PHLLTIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGGGRHTLHHSSPTSEAEEFVSRLSTQNYFRSLPRGTSNMTYGTFNFL GGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSC EGSWEDVLHLGEEAPSHLYYCQLEASACYVFTEQLGRFALVGEALSVAAAKRLKLLLFAPVACTSLEYNIRVYCLHDTHDALKEVVQLEK QLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLWKSKLLVSYQEIPFYHIWNGTQRYLHCTFTLERVSPSTSDLACKLWVWQVEGDGQSF SINFNITKDTRFAELLALESEAGVPALVGPSAFKIPFLIRQKIISSLDPPCRRGADWRTLAQKLHLDSHLSFFASKPSPTAMILNLWEAR |
| Q6ZN44-2 | MAVRPGLWPALLGIVLAAWLRGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKPVLLVCKAVPATQIFFKCNGEWVRQVDHVIE RSTDGSSGLPTMEVRINVSRQQVEKVFGLEEYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAE VEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVYVDGSWSPWSKWSACGLDCTHWRSRECSDPA |
| Q6ZN44-3 | MAGTSERSLISSISQPKAIECFEVKKKAFLTHGRYHGSGATPPKTKDPKPETFCGQTGLPTMEVRINVSRQQVEKVFGLEEYWCQCVAWS SSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAEVEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYT CVAKNIVARRRSASAAVIVYVDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGTDLDTRNCTSDLCVHTASGPEDVALYVGLI AVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLL SPLGGGRHTLHHSSPTSEAEEFVSRLSTQNYFRSLPRGTSNMTYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRL PLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSCEGSWEDVLHLGEEAPSHLYYCQLEASACYVFTEQLGRFAL VGEALSVAAAKRLKLLLFAPVACTSLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLWKSKLLV SYQEIPFYHIWNGTQRYLHCTFTLERVSPSTSDLACKLWVWQVEGDGQSFSINFNITKDTRFAELLALESEAGVPALVGPSAFKIPFLIR |
Top |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| UNC5A (go to UniProt):Q6ZN44 | |
| FUNCTION: Receptor for netrin required for axon guidance. Functions in the netrin signaling pathway and promotes neurite outgrowth in response to NTN1. Mediates axon repulsion of neuronal growth cones in the developing nervous system in response to netrin. Axon repulsion in growth cones may be mediated by its association with DCC that may trigger signaling for repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand. {ECO:0000250|UniProtKB:O08721}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Spricing information |
| Q6ZN44 | Topological domain | 26 | 306 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=296;End=301 |
| Q6ZN44 | Topological domain | 26 | 306 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=302;End=842 |
| Q6ZN44 | Topological domain | 26 | 306 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=1;End=97 |
| Q6ZN44 | Transmembrane | 307 | 327 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=302;End=842 |
| Q6ZN44 | Topological domain | 328 | 842 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=302;End=842 |
| Q6ZN44 | Domain | 44 | 141 | Note=Ig-like | Type=Substitution;Start=1;End=97 |
| Q6ZN44 | Domain | 441 | 584 | Note=ZU5;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00485 | Type=Deletion;Start=302;End=842 |
| Q6ZN44 | Domain | 761 | 841 | Note=Death | Type=Deletion;Start=302;End=842 |
| Q6ZN44 | Region | 605 | 623 | Note=Interaction with DCC;Ontology_term=ECO:0000250;evidence=ECO:0000250 | Type=Deletion;Start=302;End=842 |
Top |
Gene isoform structures and expression levels for UNC5A |
| Gene structures of our canonical and alternative spliced genes of UNC5A * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Protein Structures |
| PDB and CIF files of the predicted fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q6ZN44-1 |
| 3D view using mol* of Q6ZN44-2 |
| 3D view using mol* of Q6ZN44-3 |
Top |
pLDDT score distribution |
| pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q6ZN44-1 |
 |
| pLDDT distribution across the protein length of Q6ZN44-2 |
 |
| pLDDT distribution across the protein length of Q6ZN44-3 |
 |
Top |
Ramachandran Plot of Protein Structure |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| Ramachandran plot of Q6ZN44-2 |
 |
| Ramachandran plot of Q6ZN44-3 |
 |
Top |
Potential Active Site Information |
| The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q6ZN44-1 | 1.033 | 124 | 1.083 | 473.683 | 0.66 | 0.683 | 0.821 | 0.482 | 0.819 | 0.589 | 0.983 | 453,455,456,457,458,459,460,461,462,519,521,522,56 6,567,569,592,594,617,618,619,622,636,639,640,735, 736,739,741,742,743,809,810,812,813 |
| Q6ZN44-2 | 0.704 | 41 | 0.639 | 157.437 | 0.669 | 0.65 | 0.84 | 0.247 | 1.082 | 0.229 | 1.098 | 77,78,80,81,82,83,86,106,107,108,112,115,116,122
|
| Q6ZN44-3 | 1.024 | 433 | 1.071 | 1425.851 | 0.521 | 0.679 | 0.899 | 0.751 | 0.848 | 0.886 | 0.68 | 8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,2 5,26,42,43,44,45,46,47,48,49,50,51,52,59,60,61,62, 63,64,65,66,67,68,70,72,73,82,84,85,86,87,88,95,96 ,97,98,100,101,102,103,104,105,136,137 |
Top |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q6ZN44-1_Q6ZN44-1_4v2a_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q6ZN44-1_4v2a_A_Q6ZN44-2.pdb |
| 3D view using mol* of Q6ZN44-1_4v2a_A_Q6ZN44-3.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q6ZN44-1_Q6ZN44-2.pdb |
| 3D view using mol* of Q6ZN44-1_Q6ZN44-3.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q6ZN44-1_vs_Q6ZN44-2.png |
 < |
| ./stats/secondary_structure/figure/Q6ZN44-1_vs_Q6ZN44-3.png |
 < |
Top |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q6ZN44-1_vs_Q6ZN44-2.png |
 < |
| ./stats/relative_asa/Q6ZN44-1_vs_Q6ZN44-3.png |
 < |
Top |
Protein-Protein Interaction |
| Accession_id | Subsection | Start | End | Funcitonal feature | Spricing information |
| Q6ZN44 | Region | 605 | 623 | Note=Interaction with DCC;Ontology_term=ECO:0000250;evidence=ECO:0000250 | Type=Deletion;Start=302;End=842 |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| UNC5A |
Top |
Related Drugs to UNC5A |
| Drugs targeting this gene/protein. (DrugBank) |
| Gene | Gene | Drug | Source | PMID |
Top |
Related Diseases to UNC5A |
| Diseases associated with this gene/protein. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Previous studies relating to the alternative splicing of UNC5A and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
Top |
Clinically important variants in UNC5A |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies