|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:BRD3-LCN2 (FusionGDB2 ID:10182) |
Fusion Gene Summary for BRD3-LCN2 |
Fusion gene summary |
Fusion gene information | Fusion gene name: BRD3-LCN2 | Fusion gene ID: 10182 | Hgene | Tgene | Gene symbol | BRD3 | LCN2 | Gene ID | 8019 | 3934 |
Gene name | bromodomain containing 3 | lipocalin 2 | |
Synonyms | ORFX|RING3L | 24p3|MSFI|NGAL|p25 | |
Cytomap | 9q34.2 | 9q34.11 | |
Type of gene | protein-coding | protein-coding | |
Description | bromodomain-containing protein 3RING3-like proteinbromodomain-containing protein 3 short isoform | neutrophil gelatinase-associated lipocalin25 kDa alpha-2-microglobulin-related subunit of MMP-9migration-stimulating factor inhibitoroncogene 24p3siderocalin LCN2 | |
Modification date | 20200313 | 20200329 | |
UniProtAcc | Q15059 | P80188 | |
Ensembl transtripts involved in fusion gene | ENST00000303407, ENST00000357885, ENST00000371834, ENST00000473349, | ENST00000277480, ENST00000372998, ENST00000373013, ENST00000470902, ENST00000540948, ENST00000373017, | |
Fusion gene scores | * DoF score | 8 X 7 X 4=224 | 11 X 10 X 5=550 |
# samples | 8 | 12 | |
** MAII score | log2(8/224*10)=-1.48542682717024 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(12/550*10)=-2.1963972128035 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: BRD3 [Title/Abstract] AND LCN2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | BRD3(136917427)-LCN2(130912516), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | BRD3-LCN2 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. BRD3-LCN2 seems lost the major protein functional domain in Hgene partner, which is a epigenetic factor due to the frame-shifted ORF. BRD3-LCN2 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. BRD3-LCN2 seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | BRD3 | GO:0006357 | regulation of transcription by RNA polymerase II | 18406326 |
Tgene | LCN2 | GO:0042742 | defense response to bacterium | 27780864 |
Tgene | LCN2 | GO:0097577 | sequestering of iron ion | 27780864 |
Fusion gene breakpoints across BRD3 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across LCN2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-HU-A4H2 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
Top |
Fusion Gene ORF analysis for BRD3-LCN2 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000303407 | ENST00000277480 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000303407 | ENST00000372998 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000303407 | ENST00000373013 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000303407 | ENST00000470902 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000303407 | ENST00000540948 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000357885 | ENST00000277480 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000357885 | ENST00000372998 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000357885 | ENST00000373013 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000357885 | ENST00000470902 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000357885 | ENST00000540948 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000371834 | ENST00000277480 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000371834 | ENST00000372998 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000371834 | ENST00000373013 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000371834 | ENST00000470902 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000371834 | ENST00000540948 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
Frame-shift | ENST00000303407 | ENST00000373017 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
Frame-shift | ENST00000357885 | ENST00000373017 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
In-frame | ENST00000371834 | ENST00000373017 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
intron-3CDS | ENST00000473349 | ENST00000373017 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
intron-intron | ENST00000473349 | ENST00000277480 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
intron-intron | ENST00000473349 | ENST00000372998 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
intron-intron | ENST00000473349 | ENST00000373013 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
intron-intron | ENST00000473349 | ENST00000470902 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
intron-intron | ENST00000473349 | ENST00000540948 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000371834 | BRD3 | chr9 | 136917427 | - | ENST00000373017 | LCN2 | chr9 | 130912516 | + | 1146 | 673 | 322 | 1131 | 269 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000371834 | ENST00000373017 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + | 0.011342038 | 0.988658 |
Top |
Fusion Genomic Features for BRD3-LCN2 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + | 0.9988065 | 0.001193558 |
BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + | 0.9988065 | 0.001193558 |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for BRD3-LCN2 |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:136917427/chr9:130912516) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
BRD3 | LCN2 |
FUNCTION: Chromatin reader that recognizes and binds hyperacetylated chromatin and plays a role in the regulation of transcription, probably by chromatin remodeling and interaction with transcription factors (PubMed:18406326, PubMed:27105114). Regulates transcription by promoting the binding of the transcription factor GATA1 to its targets (By similarity). {ECO:0000250|UniProtKB:Q8K2F0, ECO:0000269|PubMed:18406326, ECO:0000269|PubMed:27105114}. | FUNCTION: Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development (PubMed:12453413, PubMed:27780864, PubMed:20581821). Binds iron through association with 2,3-dihydroxybenzoic acid (2,3-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis (By similarity). Involved in innate immunity; limits bacterial proliferation by sequestering iron bound to microbial siderophores, such as enterobactin (PubMed:27780864). Can also bind siderophores from M.tuberculosis (PubMed:15642259, PubMed:21978368). {ECO:0000250|UniProtKB:P11672, ECO:0000269|PubMed:12453413, ECO:0000269|PubMed:15642259, ECO:0000269|PubMed:20581821, ECO:0000269|PubMed:21978368, ECO:0000269|PubMed:27780864}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 78_80 | 117 | 727.0 | Region | Acetylated histone H3 binding |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 78_80 | 117 | 557.0 | Region | Acetylated histone H3 binding |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 78_80 | 117 | 557.0 | Region | Acetylated histone H3 binding |
Tgene | LCN2 | chr9:136917427 | chr9:130912516 | ENST00000277480 | 0 | 7 | 72_74 | 46 | 177.0 | Region | Carboxymycobactin binding | |
Tgene | LCN2 | chr9:136917427 | chr9:130912516 | ENST00000373017 | 1 | 7 | 72_74 | 46 | 199.0 | Region | Carboxymycobactin binding | |
Tgene | LCN2 | chr9:136917427 | chr9:130912516 | ENST00000540948 | 0 | 5 | 72_74 | 46 | 199.0 | Region | Carboxymycobactin binding |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 453_524 | 117 | 727.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 645_684 | 117 | 727.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 453_524 | 117 | 557.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 645_684 | 117 | 557.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 453_524 | 117 | 557.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 645_684 | 117 | 557.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 487_555 | 117 | 727.0 | Compositional bias | Note=Lys-rich |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 676_725 | 117 | 727.0 | Compositional bias | Note=Ser-rich |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 487_555 | 117 | 557.0 | Compositional bias | Note=Lys-rich |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 676_725 | 117 | 557.0 | Compositional bias | Note=Ser-rich |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 487_555 | 117 | 557.0 | Compositional bias | Note=Lys-rich |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 676_725 | 117 | 557.0 | Compositional bias | Note=Ser-rich |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 326_398 | 117 | 727.0 | Domain | Bromo 2 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 51_123 | 117 | 727.0 | Domain | Bromo 1 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 562_644 | 117 | 727.0 | Domain | NET |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 326_398 | 117 | 557.0 | Domain | Bromo 2 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 51_123 | 117 | 557.0 | Domain | Bromo 1 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 562_644 | 117 | 557.0 | Domain | NET |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 326_398 | 117 | 557.0 | Domain | Bromo 2 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 51_123 | 117 | 557.0 | Domain | Bromo 1 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 562_644 | 117 | 557.0 | Domain | NET |
Top |
Fusion Gene Sequence for BRD3-LCN2 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>10182_10182_1_BRD3-LCN2_BRD3_chr9_136917427_ENST00000371834_LCN2_chr9_130912516_ENST00000373017_length(transcript)=1146nt_BP=673nt CCAGGCTAATTAGGCGCGCGGTTTGTTTACAAACACGGGCTCCCGGCAGGTGCGCGCCGCCCCGCCCGTGCGCGGCCGGGGTTCGAGGGT GGCTCCCGCGGGCCTCGGGGTGCCCGGACGGGGGCTGCGGTGCTGGCTGCGTGCCCGCTTCTTCCATGCCGTCCTGGGGCACCGGAAAAT CCGCCGCCAGGCGCTGTCCCCGACACGGGCTGTCGCCTGGTTGGGCCCGGAAATGGGACGTCGCGCTTTCTCAGGGAGCGTAGAAGCAGC CAGGGCCTCTCCAAGCCGCTGCTGTGACAGAAAGTGAGTGAGCTGCCGGAGGATGTCCACCGCCACGACAGTCGCCCCCGCGGGGATCCC GGCGACCCCGGGCCCTGTGAACCCACCCCCCCCGGAGGTCTCCAACCCCAGCAAGCCCGGCCGCAAGACCAACCAGCTGCAGTACATGCA GAATGTGGTGGTGAAGACGCTCTGGAAACACCAGTTCGCCTGGCCCTTCTACCAGCCCGTGGACGCAATCAAATTGAACCTGCCGGATTA TCATAAAATAATTAAAAACCCAATGGATATGGGGACTATTAAGAAGAGACTAGAAAATAATTATTATTGGAGTGCAAGCGAATGTATGCA GGACTTCAACACCATGTTTACAAATTGTTACATTTATAACAAGTTCCAGGGGAAGTGGTATGTGGTAGGCCTGGCAGGGAATGCAATTCT CAGAGAAGACAAAGACCCGCAAAAGATGTATGCCACCATCTATGAGCTGAAAGAAGACAAGAGCTACAATGTCACCTCCGTCCTGTTTAG GAAAAAGAAGTGTGACTACTGGATCAGGACTTTTGTTCCAGGTTGCCAGCCCGGCGAGTTCACGCTGGGCAACATTAAGAGTTACCCTGG ATTAACGAGTTACCTCGTCCGAGTGGTGAGCACCAACTACAACCAGCATGCTATGGTGTTCTTCAAGAAAGTTTCTCAAAACAGGGAGTA CTTCAAGATCACCCTCTACGGGAGAACCAAGGAGCTGACTTCGGAACTAAAGGAGAACTTCATCCGCTTCTCCAAATCTCTGGGCCTCCC >10182_10182_1_BRD3-LCN2_BRD3_chr9_136917427_ENST00000371834_LCN2_chr9_130912516_ENST00000373017_length(amino acids)=269AA_BP=117 MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRL ENNYYWSASECMQDFNTMFTNCYIYNKFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQP -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for BRD3-LCN2 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for BRD3-LCN2 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for BRD3-LCN2 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |