|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:ACE2-GPR143 (FusionGDB2 ID:1276) |
Fusion Gene Summary for ACE2-GPR143 |
Fusion gene summary |
Fusion gene information | Fusion gene name: ACE2-GPR143 | Fusion gene ID: 1276 | Hgene | Tgene | Gene symbol | ACE2 | GPR143 | Gene ID | 59272 | 4935 |
Gene name | angiotensin I converting enzyme 2 | G protein-coupled receptor 143 | |
Synonyms | ACEH | NYS6|OA1 | |
Cytomap | Xp22.2 | Xp22.2 | |
Type of gene | protein-coding | protein-coding | |
Description | angiotensin-converting enzyme 2ACE-related carboxypeptidaseangiotensin I converting enzyme (peptidyl-dipeptidase A) 2angiotensin-converting enzyme homologmetalloprotease MPROT15peptidyl-dipeptidase A | G-protein coupled receptor 143ocular albinism 1ocular albinism type 1 protein | |
Modification date | 20200322 | 20200313 | |
UniProtAcc | Q9BYF1 | P51810 | |
Ensembl transtripts involved in fusion gene | ENST00000252519, ENST00000427411, ENST00000471548, | ENST00000487206, ENST00000467482, ENST00000380929, | |
Fusion gene scores | * DoF score | 1 X 1 X 1=1 | 4 X 4 X 4=64 |
# samples | 1 | 5 | |
** MAII score | log2(1/1*10)=3.32192809488736 | log2(5/64*10)=-0.356143810225275 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: ACE2 [Title/Abstract] AND GPR143 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | ACE2(15596212)-GPR143(9693880), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | ACE2-GPR143 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. ACE2-GPR143 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. ACE2-GPR143 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ACE2 | GO:0046813 | receptor-mediated virion attachment to host cell | 18343844 |
Tgene | GPR143 | GO:0007186 | G protein-coupled receptor signaling pathway | 16524428 |
Tgene | GPR143 | GO:0032400 | melanosome localization | 19717472 |
Tgene | GPR143 | GO:0032402 | melanosome transport | 19717472 |
Tgene | GPR143 | GO:0035584 | calcium-mediated signaling using intracellular calcium source | 18828673 |
Tgene | GPR143 | GO:0048015 | phosphatidylinositol-mediated signaling | 16524428 |
Tgene | GPR143 | GO:0050848 | regulation of calcium-mediated signaling | 18828673 |
Fusion gene breakpoints across ACE2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across GPR143 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | COAD | TCGA-AZ-6605-01A | ACE2 | chrX | 15596212 | - | GPR143 | chrX | 9693880 | - |
Top |
Fusion Gene ORF analysis for ACE2-GPR143 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000252519 | ENST00000487206 | ACE2 | chrX | 15596212 | - | GPR143 | chrX | 9693880 | - |
5CDS-intron | ENST00000427411 | ENST00000487206 | ACE2 | chrX | 15596212 | - | GPR143 | chrX | 9693880 | - |
Frame-shift | ENST00000252519 | ENST00000467482 | ACE2 | chrX | 15596212 | - | GPR143 | chrX | 9693880 | - |
Frame-shift | ENST00000427411 | ENST00000380929 | ACE2 | chrX | 15596212 | - | GPR143 | chrX | 9693880 | - |
In-frame | ENST00000252519 | ENST00000380929 | ACE2 | chrX | 15596212 | - | GPR143 | chrX | 9693880 | - |
In-frame | ENST00000427411 | ENST00000467482 | ACE2 | chrX | 15596212 | - | GPR143 | chrX | 9693880 | - |
intron-3CDS | ENST00000471548 | ENST00000380929 | ACE2 | chrX | 15596212 | - | GPR143 | chrX | 9693880 | - |
intron-3CDS | ENST00000471548 | ENST00000467482 | ACE2 | chrX | 15596212 | - | GPR143 | chrX | 9693880 | - |
intron-intron | ENST00000471548 | ENST00000487206 | ACE2 | chrX | 15596212 | - | GPR143 | chrX | 9693880 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000252519 | ACE2 | chrX | 15596212 | - | ENST00000380929 | GPR143 | chrX | 9693880 | - | 1827 | 1400 | 103 | 1494 | 463 |
ENST00000427411 | ACE2 | chrX | 15596212 | - | ENST00000467482 | GPR143 | chrX | 9693880 | - | 2009 | 1514 | 217 | 1608 | 463 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000252519 | ENST00000380929 | ACE2 | chrX | 15596212 | - | GPR143 | chrX | 9693880 | - | 0.000304618 | 0.9996954 |
ENST00000427411 | ENST00000467482 | ACE2 | chrX | 15596212 | - | GPR143 | chrX | 9693880 | - | 0.000228373 | 0.99977165 |
Top |
Fusion Genomic Features for ACE2-GPR143 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for ACE2-GPR143 |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chrX:15596212/chrX:9693880) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
ACE2 | GPR143 |
FUNCTION: Essential counter-regulatory carboxypeptidase of the renin-angiotensin hormone system that is a critical regulator of blood volume, systemic vascular resistance, and thus cardiovascular homeostasis (PubMed:27217402). Converts angiotensin I to angiotensin 1-9, a nine-amino acid peptide with anti-hypertrophic effects in cardiomyocytes, and angiotensin II to angiotensin 1-7, which then acts as a beneficial vasodilator and anti-proliferation agent, counterbalancing the actions of the vasoconstrictor angiotensin II (PubMed:10969042, PubMed:10924499, PubMed:11815627, PubMed:19021774, PubMed:14504186). Also removes the C-terminal residue from three other vasoactive peptides, neurotensin, kinetensin, and des-Arg bradykinin, but is not active on bradykinin (PubMed:10969042, PubMed:11815627). Also cleaves other biological peptides, such as apelins (apelin-13, [Pyr1]apelin-13, apelin-17, apelin-36), casomorphins (beta-casomorphin-7, neocasomorphin) and dynorphin A with high efficiency (PubMed:11815627, PubMed:27217402, PubMed:28293165). In addition, ACE2 C-terminus is homologous to collectrin and is responsible for the trafficking of the neutral amino acid transporter SL6A19 to the plasma membrane of gut epithelial cells via direct interaction, regulating its expression on the cell surface and its catalytic activity (PubMed:18424768, PubMed:19185582). {ECO:0000269|PubMed:10924499, ECO:0000269|PubMed:10969042, ECO:0000269|PubMed:11815627, ECO:0000269|PubMed:14504186, ECO:0000269|PubMed:18424768, ECO:0000269|PubMed:19021774, ECO:0000269|PubMed:19185582, ECO:0000269|PubMed:27217402}.; FUNCTION: [Isoform 2]: Non-functional as a carboxypeptidase. {ECO:0000269|PubMed:33077916}.; FUNCTION: (Microbial infection) Acts as a receptor for human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63. {ECO:0000269|PubMed:14647384, ECO:0000269|PubMed:15452268, ECO:0000269|PubMed:15791205, ECO:0000269|PubMed:15897467, ECO:0000269|PubMed:24227843, ECO:0000269|PubMed:32142651, ECO:0000269|PubMed:32155444, ECO:0000269|PubMed:32221306, ECO:0000269|PubMed:32225175, ECO:0000269|PubMed:33000221, ECO:0000269|PubMed:33082294, ECO:0000269|PubMed:33432067}.; FUNCTION: [Isoform 2]: (Microbial infection) Non-functional as a receptor for human coronavirus SARS-CoV-2. {ECO:0000269|PubMed:33077916, ECO:0000269|PubMed:33432184}. | FUNCTION: Receptor for tyrosine, L-DOPA and dopamine. After binding to L-DOPA, stimulates Ca(2+) influx into the cytoplasm, increases secretion of the neurotrophic factor SERPINF1 and relocalizes beta arrestin at the plasma membrane; this ligand-dependent signaling occurs through a G(q)-mediated pathway in melanocytic cells. Its activity is mediated by G proteins which activate the phosphoinositide signaling pathway. Plays also a role as an intracellular G protein-coupled receptor involved in melanosome biogenesis, organization and transport. {ECO:0000269|PubMed:10471510, ECO:0000269|PubMed:16524428, ECO:0000269|PubMed:18697795, ECO:0000269|PubMed:18828673, ECO:0000269|PubMed:19717472}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 345_346 | 432 | 806.0 | Region | Substrate binding |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 345_346 | 432 | 806.0 | Region | Substrate binding |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 778_786 | 432 | 806.0 | Motif | LIR |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 781_784 | 432 | 806.0 | Motif | Endocytic sorting signal |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 781_785 | 432 | 806.0 | Motif | SH2-binding |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 792_795 | 432 | 806.0 | Motif | PTB |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 803_805 | 432 | 806.0 | Motif | PDZ-binding |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 778_786 | 432 | 806.0 | Motif | LIR |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 781_784 | 432 | 806.0 | Motif | Endocytic sorting signal |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 781_785 | 432 | 806.0 | Motif | SH2-binding |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 792_795 | 432 | 806.0 | Motif | PTB |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 803_805 | 432 | 806.0 | Motif | PDZ-binding |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 652_659 | 432 | 806.0 | Region | Essential for cleavage by ADAM17 |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 697_716 | 432 | 806.0 | Region | Essential for cleavage by TMPRSS11D and TMPRSS2 |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 652_659 | 432 | 806.0 | Region | Essential for cleavage by ADAM17 |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 697_716 | 432 | 806.0 | Region | Essential for cleavage by TMPRSS11D and TMPRSS2 |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 18_740 | 432 | 806.0 | Topological domain | Extracellular |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 762_805 | 432 | 806.0 | Topological domain | Cytoplasmic |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 18_740 | 432 | 806.0 | Topological domain | Extracellular |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 762_805 | 432 | 806.0 | Topological domain | Cytoplasmic |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 741_761 | 432 | 806.0 | Transmembrane | Helical |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 741_761 | 432 | 806.0 | Transmembrane | Helical |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 222_231 | 393 | 425.0 | Motif | Note=lysosomal/melanosomal membrane localization signal | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 222_231 | 373 | 405.0 | Motif | Note=lysosomal/melanosomal membrane localization signal | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 221_238 | 393 | 425.0 | Region | Note=Necessary for its G protein-activation ability and normal distribution of melanosomes | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 221_238 | 373 | 405.0 | Region | Note=Necessary for its G protein-activation ability and normal distribution of melanosomes | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 100_124 | 393 | 425.0 | Topological domain | Extracellular | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 146_149 | 393 | 425.0 | Topological domain | Cytoplasmic | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 171_191 | 393 | 425.0 | Topological domain | Extracellular | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 1_28 | 393 | 425.0 | Topological domain | Extracellular | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 213_248 | 393 | 425.0 | Topological domain | Cytoplasmic | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 270_292 | 393 | 425.0 | Topological domain | Extracellular | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 314_404 | 393 | 425.0 | Topological domain | Cytoplasmic | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 50_78 | 393 | 425.0 | Topological domain | Cytoplasmic | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 100_124 | 373 | 405.0 | Topological domain | Extracellular | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 146_149 | 373 | 405.0 | Topological domain | Cytoplasmic | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 171_191 | 373 | 405.0 | Topological domain | Extracellular | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 1_28 | 373 | 405.0 | Topological domain | Extracellular | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 213_248 | 373 | 405.0 | Topological domain | Cytoplasmic | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 270_292 | 373 | 405.0 | Topological domain | Extracellular | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 314_404 | 373 | 405.0 | Topological domain | Cytoplasmic | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 50_78 | 373 | 405.0 | Topological domain | Cytoplasmic | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 125_145 | 393 | 425.0 | Transmembrane | Helical%3B Name%3D3 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 150_170 | 393 | 425.0 | Transmembrane | Helical%3B Name%3D4 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 192_212 | 393 | 425.0 | Transmembrane | Helical%3B Name%3D5 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 249_269 | 393 | 425.0 | Transmembrane | Helical%3B Name%3D6 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 293_313 | 393 | 425.0 | Transmembrane | Helical%3B Name%3D7 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 29_49 | 393 | 425.0 | Transmembrane | Helical%3B Name%3D1 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000380929 | 7 | 9 | 79_99 | 393 | 425.0 | Transmembrane | Helical%3B Name%3D2 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 125_145 | 373 | 405.0 | Transmembrane | Helical%3B Name%3D3 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 150_170 | 373 | 405.0 | Transmembrane | Helical%3B Name%3D4 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 192_212 | 373 | 405.0 | Transmembrane | Helical%3B Name%3D5 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 249_269 | 373 | 405.0 | Transmembrane | Helical%3B Name%3D6 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 293_313 | 373 | 405.0 | Transmembrane | Helical%3B Name%3D7 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 29_49 | 373 | 405.0 | Transmembrane | Helical%3B Name%3D1 | |
Tgene | GPR143 | chrX:15596212 | chrX:9693880 | ENST00000467482 | 7 | 9 | 79_99 | 373 | 405.0 | Transmembrane | Helical%3B Name%3D2 |
Top |
Fusion Gene Sequence for ACE2-GPR143 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>1276_1276_1_ACE2-GPR143_ACE2_chrX_15596212_ENST00000252519_GPR143_chrX_9693880_ENST00000380929_length(transcript)=1827nt_BP=1400nt CGCCCAACCCAAGTTCAAAGGCTGATAAGAGAGAAAATCTCATGAGGAGGTTTTAGTCTAGGGAAAGTCATTCAGTGGATGTGATCTTGG CTCACAGGGGACGATGTCAAGCTCTTCCTGGCTCCTTCTCAGCCTTGTTGCTGTAACTGCTGCTCAGTCCACCATTGAGGAACAGGCCAA GACATTTTTGGACAAGTTTAACCACGAAGCCGAAGACCTGTTCTATCAAAGTTCACTTGCTTCTTGGAATTATAACACCAATATTACTGA AGAGAATGTCCAAAACATGAATAATGCTGGGGACAAATGGTCTGCCTTTTTAAAGGAACAGTCCACACTTGCCCAAATGTATCCACTACA AGAAATTCAGAATCTCACAGTCAAGCTTCAGCTGCAGGCTCTTCAGCAAAATGGGTCTTCAGTGCTCTCAGAAGACAAGAGCAAACGGTT GAACACAATTCTAAATACAATGAGCACCATCTACAGTACTGGAAAAGTTTGTAACCCAGATAATCCACAAGAATGCTTATTACTTGAACC AGGTTTGAATGAAATAATGGCAAACAGTTTAGACTACAATGAGAGGCTCTGGGCTTGGGAAAGCTGGAGATCTGAGGTCGGCAAGCAGCT GAGGCCATTATATGAAGAGTATGTGGTCTTGAAAAATGAGATGGCAAGAGCAAATCATTATGAGGACTATGGGGATTATTGGAGAGGAGA CTATGAAGTAAATGGGGTAGATGGCTATGACTACAGCCGCGGCCAGTTGATTGAAGATGTGGAACATACCTTTGAAGAGATTAAACCATT ATATGAACATCTTCATGCCTATGTGAGGGCAAAGTTGATGAATGCCTATCCTTCCTATATCAGTCCAATTGGATGCCTCCCTGCTCATTT GCTTGGTGATATGTGGGGTAGATTTTGGACAAATCTGTACTCTTTGACAGTTCCCTTTGGACAGAAACCAAACATAGATGTTACTGATGC AATGGTGGACCAGGCCTGGGATGCACAGAGAATATTCAAGGAGGCCGAGAAGTTCTTTGTATCTGTTGGTCTTCCTAATATGACTCAAGG ATTCTGGGAAAATTCCATGCTAACGGACCCAGGAAATGTTCAGAAAGCAGTCTGCCATCCCACAGCTTGGGACCTGGGGAAGGGCGACTT CAGGATCCTTATGTGCACAAAGGTGACAATGGACGACTTCCTGACAGCTCATCATGAGATGGGGCATATCCAGTATGATATGGCATATGC TGCACAACCTTTTCTGCTAAGAAATGGAGCTAATGAAGGATTCCATGAAGCTGTTGGGGAAATCATGTCACTTTCTGCAGCCACACCTAA GCATTTAAAATCCATTGGTCTTCTGTCACCCGATTTTCAAGAAGACAATGGTTCTGATGCCAGCACAATTGAAATTCACACTGCAAGTGA ATCCTGCAACAAAAATGAGGGTGACCCTGCTCTCCCAACCCATGGAGACCTATGAAGGGGATGTGCTGGGGGTCCAGACCCCATATTCCT CAGACTCAACAATTCTTGTTCTTTAGAACTGTGTTCTCACCTTCCCAACACTGCACTGCCGAAGTGTAGCGGCCCCCAAACCTTGCTCTC ATCACCAGCTAGAGCTTCTTCCCGAAGGGCCTTTAGGATAGGAGAAAGGGTTCATGCACACACGTGTGAGAATGGAAGAGCCCCCTCCAG ACCACTCTACAGCTGCTCTAGCCTTAGTTGCCACTAGGAAGTTTTCTGAGGCTGGCTGTAAAGTAAGTGTAAGGTCCACATCCTTGGGGA >1276_1276_1_ACE2-GPR143_ACE2_chrX_15596212_ENST00000252519_GPR143_chrX_9693880_ENST00000380929_length(amino acids)=463AA_BP=432 MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQN LTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDM WGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILM CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNGSDASTIEIHTASESCNK -------------------------------------------------------------- >1276_1276_2_ACE2-GPR143_ACE2_chrX_15596212_ENST00000427411_GPR143_chrX_9693880_ENST00000467482_length(transcript)=2009nt_BP=1514nt GTTGTTGTGATCCCATGGCTACAGAGGATCAGGAGTTGACATAGATACTCTTTGGATTTCATACCATGTGGAGGCTTTCTTACTTCCACG TGACCTTGACTGAGTTTTGAATAGCGCCCAACCCAAGTTCAAAGGCTGATAAGAGAGAAAATCTCATGAGGAGGTTTTAGTCTAGGGAAA GTCATTCAGTGGATGTGATCTTGGCTCACAGGGGACGATGTCAAGCTCTTCCTGGCTCCTTCTCAGCCTTGTTGCTGTAACTGCTGCTCA GTCCACCATTGAGGAACAGGCCAAGACATTTTTGGACAAGTTTAACCACGAAGCCGAAGACCTGTTCTATCAAAGTTCACTTGCTTCTTG GAATTATAACACCAATATTACTGAAGAGAATGTCCAAAACATGAATAATGCTGGGGACAAATGGTCTGCCTTTTTAAAGGAACAGTCCAC ACTTGCCCAAATGTATCCACTACAAGAAATTCAGAATCTCACAGTCAAGCTTCAGCTGCAGGCTCTTCAGCAAAATGGGTCTTCAGTGCT CTCAGAAGACAAGAGCAAACGGTTGAACACAATTCTAAATACAATGAGCACCATCTACAGTACTGGAAAAGTTTGTAACCCAGATAATCC ACAAGAATGCTTATTACTTGAACCAGGTTTGAATGAAATAATGGCAAACAGTTTAGACTACAATGAGAGGCTCTGGGCTTGGGAAAGCTG GAGATCTGAGGTCGGCAAGCAGCTGAGGCCATTATATGAAGAGTATGTGGTCTTGAAAAATGAGATGGCAAGAGCAAATCATTATGAGGA CTATGGGGATTATTGGAGAGGAGACTATGAAGTAAATGGGGTAGATGGCTATGACTACAGCCGCGGCCAGTTGATTGAAGATGTGGAACA TACCTTTGAAGAGATTAAACCATTATATGAACATCTTCATGCCTATGTGAGGGCAAAGTTGATGAATGCCTATCCTTCCTATATCAGTCC AATTGGATGCCTCCCTGCTCATTTGCTTGGTGATATGTGGGGTAGATTTTGGACAAATCTGTACTCTTTGACAGTTCCCTTTGGACAGAA ACCAAACATAGATGTTACTGATGCAATGGTGGACCAGGCCTGGGATGCACAGAGAATATTCAAGGAGGCCGAGAAGTTCTTTGTATCTGT TGGTCTTCCTAATATGACTCAAGGATTCTGGGAAAATTCCATGCTAACGGACCCAGGAAATGTTCAGAAAGCAGTCTGCCATCCCACAGC TTGGGACCTGGGGAAGGGCGACTTCAGGATCCTTATGTGCACAAAGGTGACAATGGACGACTTCCTGACAGCTCATCATGAGATGGGGCA TATCCAGTATGATATGGCATATGCTGCACAACCTTTTCTGCTAAGAAATGGAGCTAATGAAGGATTCCATGAAGCTGTTGGGGAAATCAT GTCACTTTCTGCAGCCACACCTAAGCATTTAAAATCCATTGGTCTTCTGTCACCCGATTTTCAAGAAGACAATGGTTCTGATGCCAGCAC AATTGAAATTCACACTGCAAGTGAATCCTGCAACAAAAATGAGGGTGACCCTGCTCTCCCAACCCATGGAGACCTATGAAGGGGATGTGC TGGGGGTCCAGACCCCATATTCCTCAGACTCAACAATTCTTGTTCTTTAGAACTGTGTTCTCACCTTCCCAACACTGCACTGCCGAAGTG TAGCGGCCCCCAAACCTTGCTCTCATCACCAGCTAGAGCTTCTTCCCGAAGGGCCTTTAGGATAGGAGAAAGGGTTCATGCACACACGTG TGAGAATGGAAGAGCCCCCTCCAGACCACTCTACAGCTGCTCTAGCCTTAGTTGCCACTAGGAAGTTTTCTGAGGCTGGCTGTAAAGTAA GTGTAAGGTCCACATCCTTGGGGAAGTAGTTAAATAAAATAGTTATGACTGAGCTCTCAGCCTGACTTGGATTCTGTCTTAACACTTCTA >1276_1276_2_ACE2-GPR143_ACE2_chrX_15596212_ENST00000427411_GPR143_chrX_9693880_ENST00000467482_length(amino acids)=463AA_BP=432 MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQN LTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDM WGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILM CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNGSDASTIEIHTASESCNK -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ACE2-GPR143 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 30_41 | 432.3333333333333 | 806.0 | SARS-CoV spike glycoprotein |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000252519 | - | 9 | 18 | 353_357 | 432.3333333333333 | 806.0 | SARS-CoV spike glycoprotein |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 30_41 | 432.3333333333333 | 806.0 | SARS-CoV spike glycoprotein |
Hgene | ACE2 | chrX:15596212 | chrX:9693880 | ENST00000427411 | - | 10 | 19 | 353_357 | 432.3333333333333 | 806.0 | SARS-CoV spike glycoprotein |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ACE2-GPR143 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for ACE2-GPR143 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |