|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:CDC5L-VEGFA (FusionGDB2 ID:14927) |
Fusion Gene Summary for CDC5L-VEGFA |
Fusion gene summary |
Fusion gene information | Fusion gene name: CDC5L-VEGFA | Fusion gene ID: 14927 | Hgene | Tgene | Gene symbol | CDC5L | VEGFA | Gene ID | 988 | 7422 |
Gene name | cell division cycle 5 like | vascular endothelial growth factor A | |
Synonyms | CDC5|CDC5-LIKE|CEF1|PCDC5RP|dJ319D22.1 | MVCD1|VEGF|VPF | |
Cytomap | 6p21.1 | 6p21.1 | |
Type of gene | protein-coding | protein-coding | |
Description | cell division cycle 5-like proteinCDC5 cell division cycle 5-likeCdc5-related proteindJ319D22.1 (CDC5-like protein)pombe cdc5-related protein | vascular endothelial growth factor Avascular endothelial growth factor A121vascular endothelial growth factor A165vascular permeability factor | |
Modification date | 20200313 | 20200329 | |
UniProtAcc | Q99459 | . | |
Ensembl transtripts involved in fusion gene | ENST00000371477, | ENST00000230480, ENST00000372064, ENST00000372077, ENST00000425836, ENST00000457104, ENST00000482630, ENST00000518689, ENST00000518824, ENST00000520948, ENST00000523125, ENST00000523873, ENST00000523950, ENST00000372055, ENST00000372067, ENST00000417285, ENST00000324450, ENST00000413642, | |
Fusion gene scores | * DoF score | 10 X 4 X 7=280 | 10 X 9 X 5=450 |
# samples | 11 | 13 | |
** MAII score | log2(11/280*10)=-1.34792330342031 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(13/450*10)=-1.79141337818858 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: CDC5L [Title/Abstract] AND VEGFA [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | CDC5L(44376369)-VEGFA(43752278), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | CDC5L-VEGFA seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. CDC5L-VEGFA seems lost the major protein functional domain in Hgene partner, which is a transcription factor due to the frame-shifted ORF. CDC5L-VEGFA seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CDC5L | GO:0000398 | mRNA splicing, via spliceosome | 28076346 |
Hgene | CDC5L | GO:0045944 | positive regulation of transcription by RNA polymerase II | 11082045 |
Tgene | VEGFA | GO:0000122 | negative regulation of transcription by RNA polymerase II | 18093989 |
Tgene | VEGFA | GO:0001525 | angiogenesis | 11427521|21771332 |
Tgene | VEGFA | GO:0001666 | response to hypoxia | 16490744 |
Tgene | VEGFA | GO:0001934 | positive regulation of protein phosphorylation | 18386220|19033661 |
Tgene | VEGFA | GO:0001938 | positive regulation of endothelial cell proliferation | 9202027|10022831|12714610|16489009|18386220|18577655|20497126 |
Tgene | VEGFA | GO:0002042 | cell migration involved in sprouting angiogenesis | 18059339|20660291 |
Tgene | VEGFA | GO:0002092 | positive regulation of receptor internalization | 20660291 |
Tgene | VEGFA | GO:0008284 | positive regulation of cell proliferation | 7929439 |
Tgene | VEGFA | GO:0008360 | regulation of cell shape | 7929439|10527820 |
Tgene | VEGFA | GO:0010595 | positive regulation of endothelial cell migration | 10022831|19033661 |
Tgene | VEGFA | GO:0010628 | positive regulation of gene expression | 18386220 |
Tgene | VEGFA | GO:0010629 | negative regulation of gene expression | 28977001 |
Tgene | VEGFA | GO:0010749 | regulation of nitric oxide mediated signal transduction | 16150726 |
Tgene | VEGFA | GO:0030224 | monocyte differentiation | 21149635 |
Tgene | VEGFA | GO:0030225 | macrophage differentiation | 21149635 |
Tgene | VEGFA | GO:0030335 | positive regulation of cell migration | 7929439|17470632 |
Tgene | VEGFA | GO:0030949 | positive regulation of vascular endothelial growth factor receptor signaling pathway | 1312256|7929439 |
Tgene | VEGFA | GO:0031334 | positive regulation of protein complex assembly | 16489009|19033661 |
Tgene | VEGFA | GO:0031954 | positive regulation of protein autophosphorylation | 20497126 |
Tgene | VEGFA | GO:0032147 | activation of protein kinase activity | 18059339|20497126 |
Tgene | VEGFA | GO:0032793 | positive regulation of CREB transcription factor activity | 20497126 |
Tgene | VEGFA | GO:0033138 | positive regulation of peptidyl-serine phosphorylation | 18440775|20497126 |
Tgene | VEGFA | GO:0035148 | tube formation | 19033661 |
Tgene | VEGFA | GO:0035767 | endothelial cell chemotaxis | 18440775 |
Tgene | VEGFA | GO:0035924 | cellular response to vascular endothelial growth factor stimulus | 18440775|20497126 |
Tgene | VEGFA | GO:0038033 | positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway | 18440775|20497126|21245381 |
Tgene | VEGFA | GO:0038091 | positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway | 17470632 |
Tgene | VEGFA | GO:0042531 | positive regulation of tyrosine phosphorylation of STAT protein | 19390056 |
Tgene | VEGFA | GO:0043117 | positive regulation of vascular permeability | 26598555 |
Tgene | VEGFA | GO:0043154 | negative regulation of cysteine-type endopeptidase activity involved in apoptotic process | 18386220 |
Tgene | VEGFA | GO:0043406 | positive regulation of MAP kinase activity | 18440775 |
Tgene | VEGFA | GO:0043536 | positive regulation of blood vessel endothelial cell migration | 9202027|18440775|20497126 |
Tgene | VEGFA | GO:0045766 | positive regulation of angiogenesis | 18440775|18577655|19033661|20497126 |
Tgene | VEGFA | GO:0045785 | positive regulation of cell adhesion | 19674970 |
Tgene | VEGFA | GO:0045944 | positive regulation of transcription by RNA polymerase II | 18059339 |
Tgene | VEGFA | GO:0048010 | vascular endothelial growth factor receptor signaling pathway | 21245381 |
Tgene | VEGFA | GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | 10022831|16489009|20048167|21245381|26598555 |
Tgene | VEGFA | GO:0050918 | positive chemotaxis | 20497126 |
Tgene | VEGFA | GO:0050927 | positive regulation of positive chemotaxis | 7929439|12744932 |
Tgene | VEGFA | GO:0051272 | positive regulation of cellular component movement | 10527820|12744932 |
Tgene | VEGFA | GO:0051894 | positive regulation of focal adhesion assembly | 16489009 |
Tgene | VEGFA | GO:0071456 | cellular response to hypoxia | 10575000 |
Tgene | VEGFA | GO:0090037 | positive regulation of protein kinase C signaling | 18059339 |
Tgene | VEGFA | GO:0090050 | positive regulation of cell migration involved in sprouting angiogenesis | 20551324 |
Tgene | VEGFA | GO:0097533 | cellular stress response to acid chemical | 26299712 |
Tgene | VEGFA | GO:1900086 | positive regulation of peptidyl-tyrosine autophosphorylation | 20660291 |
Tgene | VEGFA | GO:1900745 | positive regulation of p38MAPK cascade | 18386220 |
Tgene | VEGFA | GO:1901727 | positive regulation of histone deacetylase activity | 20497126 |
Tgene | VEGFA | GO:1903141 | negative regulation of establishment of endothelial barrier | 20048167 |
Tgene | VEGFA | GO:1903392 | negative regulation of adherens junction organization | 26598555 |
Tgene | VEGFA | GO:1903572 | positive regulation of protein kinase D signaling | 20497126 |
Tgene | VEGFA | GO:1903672 | positive regulation of sprouting angiogenesis | 26299712 |
Tgene | VEGFA | GO:2000048 | negative regulation of cell-cell adhesion mediated by cadherin | 26598555 |
Fusion gene breakpoints across CDC5L (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across VEGFA (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-A7-A26G-01A | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
Top |
Fusion Gene ORF analysis for CDC5L-VEGFA |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000371477 | ENST00000230480 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
5CDS-intron | ENST00000371477 | ENST00000372064 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
5CDS-intron | ENST00000371477 | ENST00000372077 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
5CDS-intron | ENST00000371477 | ENST00000425836 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
5CDS-intron | ENST00000371477 | ENST00000457104 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
5CDS-intron | ENST00000371477 | ENST00000482630 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
5CDS-intron | ENST00000371477 | ENST00000518689 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
5CDS-intron | ENST00000371477 | ENST00000518824 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
5CDS-intron | ENST00000371477 | ENST00000520948 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
5CDS-intron | ENST00000371477 | ENST00000523125 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
5CDS-intron | ENST00000371477 | ENST00000523873 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
5CDS-intron | ENST00000371477 | ENST00000523950 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
Frame-shift | ENST00000371477 | ENST00000372055 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
Frame-shift | ENST00000371477 | ENST00000372067 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
Frame-shift | ENST00000371477 | ENST00000417285 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
In-frame | ENST00000371477 | ENST00000324450 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
In-frame | ENST00000371477 | ENST00000413642 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000371477 | CDC5L | chr6 | 44376369 | + | ENST00000324450 | VEGFA | chr6 | 43752278 | + | 1413 | 1391 | 275 | 1396 | 373 |
ENST00000371477 | CDC5L | chr6 | 44376369 | + | ENST00000413642 | VEGFA | chr6 | 43752278 | + | 1440 | 1391 | 275 | 1396 | 373 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000371477 | ENST00000324450 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + | 0.001572438 | 0.9984276 |
ENST00000371477 | ENST00000413642 | CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752278 | + | 0.001594428 | 0.99840564 |
Top |
Fusion Genomic Features for CDC5L-VEGFA |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752277 | + | 0.000128753 | 0.99987125 |
CDC5L | chr6 | 44376369 | + | VEGFA | chr6 | 43752277 | + | 0.000128753 | 0.99987125 |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for CDC5L-VEGFA |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr6:44376369/chr6:43752278) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
CDC5L | . |
FUNCTION: DNA-binding protein involved in cell cycle control. May act as a transcription activator. Plays role in pre-mRNA splicing as core component of precatalytic, catalytic and postcatalytic spliceosomal complexes (PubMed:11991638, PubMed:20176811, PubMed:28502770, PubMed:28076346, PubMed:29361316, PubMed:29360106, PubMed:29301961, PubMed:30728453, PubMed:30705154). Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR) (PubMed:20176811). {ECO:0000269|PubMed:10570151, ECO:0000269|PubMed:11082045, ECO:0000269|PubMed:11101529, ECO:0000269|PubMed:11544257, ECO:0000269|PubMed:11991638, ECO:0000269|PubMed:12927788, ECO:0000269|PubMed:18583928, ECO:0000269|PubMed:20176811, ECO:0000269|PubMed:24332808, ECO:0000269|PubMed:28076346, ECO:0000269|PubMed:28502770, ECO:0000269|PubMed:29301961, ECO:0000269|PubMed:29360106, ECO:0000269|PubMed:29361316, ECO:0000269|PubMed:30705154, ECO:0000269|PubMed:30728453, ECO:0000269|PubMed:9038199, ECO:0000269|PubMed:9468527, ECO:0000269|PubMed:9632794}. | FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CDC5L | chr6:44376369 | chr6:43752278 | ENST00000371477 | + | 8 | 16 | 142_245 | 364 | 803.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | CDC5L | chr6:44376369 | chr6:43752278 | ENST00000371477 | + | 8 | 16 | 31_54 | 364 | 803.0 | DNA binding | H-T-H motif |
Hgene | CDC5L | chr6:44376369 | chr6:43752278 | ENST00000371477 | + | 8 | 16 | 82_104 | 364 | 803.0 | DNA binding | H-T-H motif |
Hgene | CDC5L | chr6:44376369 | chr6:43752278 | ENST00000371477 | + | 8 | 16 | 1_56 | 364 | 803.0 | Domain | HTH myb-type 1 |
Hgene | CDC5L | chr6:44376369 | chr6:43752278 | ENST00000371477 | + | 8 | 16 | 57_108 | 364 | 803.0 | Domain | HTH myb-type 2 |
Hgene | CDC5L | chr6:44376369 | chr6:43752278 | ENST00000371477 | + | 8 | 16 | 165_271 | 364 | 803.0 | Motif | Nuclear localization signal |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CDC5L | chr6:44376369 | chr6:43752278 | ENST00000371477 | + | 8 | 16 | 676_701 | 364 | 803.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | CDC5L | chr6:44376369 | chr6:43752278 | ENST00000371477 | + | 8 | 16 | 764_802 | 364 | 803.0 | Coiled coil | Ontology_term=ECO:0000255 |
Top |
Fusion Gene Sequence for CDC5L-VEGFA |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>14927_14927_1_CDC5L-VEGFA_CDC5L_chr6_44376369_ENST00000371477_VEGFA_chr6_43752278_ENST00000324450_length(transcript)=1413nt_BP=1391nt TTTCTTCCATTCTGTTTTGGACATGCGCGGGGCGTAAGGCGCTTTGGCCAGAGTGGTTTGATGGTTTTGTGTTAGTCTTCCTGCAGCTGA GCTTCCACAAGACACTTTTTCCCTTTCAGCCACCCAATATCTCGCGAGACTTGCTATTCTGCGCCCCCTCCCACCTTGCGCTTGCGCAGA TCTTCAAAGCAGAAGGTCGCGCTTGGAGGAAGTGGCGGCTTTGAGTCCGGTGGCCCAATCGCTGTTACTACTTCTCTGAAGCTCCTCTCG GCTGCTTGCCGAGACACCCTGCCGCCAAGATGCCTCGAATTATGATCAAGGGGGGCGTATGGAGGAATACCGAGGATGAAATTCTGAAAG CAGCGGTAATGAAATATGGGAAAAATCAGTGGTCTAGGATTGCCTCATTGCTGCATAGAAAATCAGCAAAGCAGTGCAAAGCCAGATGGT ATGAATGGCTGGATCCAAGCATTAAGAAGACAGAATGGTCCAGAGAAGAAGAGGAAAAACTCTTGCACTTGGCCAAGTTGATGCCAACTC AGTGGAGGACCATTGCTCCAATCATTGGAAGAACAGCGGCCCAGTGCTTAGAACACTATGAATTTCTTCTGGATAAAGCTGCCCAAAGAG ACAATGAAGAGGAAACAACAGATGATCCACGAAAACTTAAACCTGGAGAAATAGATCCAAATCCAGAAACAAAACCAGCGCGGCCTGATC CAATTGATATGGATGAGGATGAACTTGAGATGCTTTCTGAAGCCAGAGCCCGCTTGGCTAATACTCAGGGAAAGAAGGCCAAGAGGAAAG CAAGAGAGAAACAATTGGAAGAAGCAAGACGTCTTGCTGCCCTCCAAAAAAGAAGAGAACTTCGAGCAGCTGGCATAGAAATTCAGAAGA AAAGAAAAAGGAAGAGAGGAGTTGATTATAATGCCGAAATCCCATTTGAAAAAAAGCCTGCCCTTGGTTTTTATGATACTTCTGAGGAAA ACTACCAAGCTCTTGACGCAGATTTCAGGAAATTAAGACAACAGGATCTTGATGGGGAGCTAAGATCTGAAAAAGAAGGAAGAGATAGAA AAAAAGACAAACAGCATTTGAAAAGGAAAAAAGAATCTGATTTACCATCAGCTATTCTTCAAACTAGTGGTGTTTCTGAATTTACTAAAA AGAGAAGCAAACTAGTACTTCCTGCCCCTCAGATTTCAGATGCAGAACTCCAGGAAGTTGTAAAAGTAGGCCAAGCGAGTGAAATTGCAC GTCAAACTGCCGAGGAATCTGGCATAACAAATTCTGCTTCCAGTACACTTTTGTCTGAGTACAATGTCACCAACAACAGCGTTGCTCTTA >14927_14927_1_CDC5L-VEGFA_CDC5L_chr6_44376369_ENST00000371477_VEGFA_chr6_43752278_ENST00000324450_length(amino acids)=373AA_BP= MPRHPAAKMPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQW RTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAR EKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKK DKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRT -------------------------------------------------------------- >14927_14927_2_CDC5L-VEGFA_CDC5L_chr6_44376369_ENST00000371477_VEGFA_chr6_43752278_ENST00000413642_length(transcript)=1440nt_BP=1391nt TTTCTTCCATTCTGTTTTGGACATGCGCGGGGCGTAAGGCGCTTTGGCCAGAGTGGTTTGATGGTTTTGTGTTAGTCTTCCTGCAGCTGA GCTTCCACAAGACACTTTTTCCCTTTCAGCCACCCAATATCTCGCGAGACTTGCTATTCTGCGCCCCCTCCCACCTTGCGCTTGCGCAGA TCTTCAAAGCAGAAGGTCGCGCTTGGAGGAAGTGGCGGCTTTGAGTCCGGTGGCCCAATCGCTGTTACTACTTCTCTGAAGCTCCTCTCG GCTGCTTGCCGAGACACCCTGCCGCCAAGATGCCTCGAATTATGATCAAGGGGGGCGTATGGAGGAATACCGAGGATGAAATTCTGAAAG CAGCGGTAATGAAATATGGGAAAAATCAGTGGTCTAGGATTGCCTCATTGCTGCATAGAAAATCAGCAAAGCAGTGCAAAGCCAGATGGT ATGAATGGCTGGATCCAAGCATTAAGAAGACAGAATGGTCCAGAGAAGAAGAGGAAAAACTCTTGCACTTGGCCAAGTTGATGCCAACTC AGTGGAGGACCATTGCTCCAATCATTGGAAGAACAGCGGCCCAGTGCTTAGAACACTATGAATTTCTTCTGGATAAAGCTGCCCAAAGAG ACAATGAAGAGGAAACAACAGATGATCCACGAAAACTTAAACCTGGAGAAATAGATCCAAATCCAGAAACAAAACCAGCGCGGCCTGATC CAATTGATATGGATGAGGATGAACTTGAGATGCTTTCTGAAGCCAGAGCCCGCTTGGCTAATACTCAGGGAAAGAAGGCCAAGAGGAAAG CAAGAGAGAAACAATTGGAAGAAGCAAGACGTCTTGCTGCCCTCCAAAAAAGAAGAGAACTTCGAGCAGCTGGCATAGAAATTCAGAAGA AAAGAAAAAGGAAGAGAGGAGTTGATTATAATGCCGAAATCCCATTTGAAAAAAAGCCTGCCCTTGGTTTTTATGATACTTCTGAGGAAA ACTACCAAGCTCTTGACGCAGATTTCAGGAAATTAAGACAACAGGATCTTGATGGGGAGCTAAGATCTGAAAAAGAAGGAAGAGATAGAA AAAAAGACAAACAGCATTTGAAAAGGAAAAAAGAATCTGATTTACCATCAGCTATTCTTCAAACTAGTGGTGTTTCTGAATTTACTAAAA AGAGAAGCAAACTAGTACTTCCTGCCCCTCAGATTTCAGATGCAGAACTCCAGGAAGTTGTAAAAGTAGGCCAAGCGAGTGAAATTGCAC GTCAAACTGCCGAGGAATCTGGCATAACAAATTCTGCTTCCAGTACACTTTTGTCTGAGTACAATGTCACCAACAACAGCGTTGCTCTTA GAACACCACGAACACCAGCTTCCCAGGACAGAATTCTGCAGATGTGACAAGCCGAGGCGGTGAGCCGGGCAGGAGGAAGGAGCCTCCCTC >14927_14927_2_CDC5L-VEGFA_CDC5L_chr6_44376369_ENST00000371477_VEGFA_chr6_43752278_ENST00000413642_length(amino acids)=373AA_BP= MPRHPAAKMPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQW RTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAR EKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKK DKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRT -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for CDC5L-VEGFA |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Hgene | CDC5L | chr6:44376369 | chr6:43752278 | ENST00000371477 | + | 8 | 16 | 501_659 | 364.0 | 803.0 | DAPK3 |
Hgene | CDC5L | chr6:44376369 | chr6:43752278 | ENST00000371477 | + | 8 | 16 | 706_800 | 364.0 | 803.0 | PLRG1 |
Hgene | CDC5L | chr6:44376369 | chr6:43752278 | ENST00000371477 | + | 8 | 16 | 260_606 | 364.0 | 803.0 | PPP1R8 |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for CDC5L-VEGFA |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for CDC5L-VEGFA |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |