|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:CXCL17-EXOSC5 (FusionGDB2 ID:20830) |
Fusion Gene Summary for CXCL17-EXOSC5 |
Fusion gene summary |
Fusion gene information | Fusion gene name: CXCL17-EXOSC5 | Fusion gene ID: 20830 | Hgene | Tgene | Gene symbol | CXCL17 | EXOSC5 | Gene ID | 284340 | 56915 |
Gene name | C-X-C motif chemokine ligand 17 | exosome component 5 | |
Synonyms | DMC|Dcip1|UNQ473|VCC-1|VCC1 | RRP41B|RRP46|Rrp46p|hRrp46p|p12B | |
Cytomap | 19q13.2 | 19q13.2 | |
Type of gene | protein-coding | protein-coding | |
Description | C-X-C motif chemokine 176-Cys CXCL17VEGF co-regulated chemokine 1VEGF coregulated chemokine 1chemokine (C-X-C motif) ligand 17dendritic cell and monocyte chemokine-like protein | exosome complex component RRP46chronic myelogenous leukemia tumor antigen 28exosome complex exonuclease RRP46exosome component Rrp46ribosomal RNA-processing protein 46 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q6UXB2 | Q9NQT4 | |
Ensembl transtripts involved in fusion gene | ENST00000601181, | ENST00000221233, ENST00000596905, | |
Fusion gene scores | * DoF score | 1 X 1 X 1=1 | 3 X 3 X 3=27 |
# samples | 1 | 3 | |
** MAII score | log2(1/1*10)=3.32192809488736 | log2(3/27*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
Context | PubMed: CXCL17 [Title/Abstract] AND EXOSC5 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | CXCL17(42937128)-EXOSC5(41897867), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | EXOSC5 | GO:0045006 | DNA deamination | 21255825 |
Fusion gene breakpoints across CXCL17 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across EXOSC5 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LUAD | TCGA-35-5375-01A | CXCL17 | chr19 | 42937128 | - | EXOSC5 | chr19 | 41897867 | - |
Top |
Fusion Gene ORF analysis for CXCL17-EXOSC5 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
In-frame | ENST00000601181 | ENST00000221233 | CXCL17 | chr19 | 42937128 | - | EXOSC5 | chr19 | 41897867 | - |
In-frame | ENST00000601181 | ENST00000596905 | CXCL17 | chr19 | 42937128 | - | EXOSC5 | chr19 | 41897867 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000601181 | CXCL17 | chr19 | 42937128 | - | ENST00000221233 | EXOSC5 | chr19 | 41897867 | - | 1183 | 478 | 129 | 923 | 264 |
ENST00000601181 | CXCL17 | chr19 | 42937128 | - | ENST00000596905 | EXOSC5 | chr19 | 41897867 | - | 1142 | 478 | 129 | 923 | 264 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000601181 | ENST00000221233 | CXCL17 | chr19 | 42937128 | - | EXOSC5 | chr19 | 41897867 | - | 0.029111372 | 0.9708887 |
ENST00000601181 | ENST00000596905 | CXCL17 | chr19 | 42937128 | - | EXOSC5 | chr19 | 41897867 | - | 0.028026544 | 0.9719734 |
Top |
Fusion Genomic Features for CXCL17-EXOSC5 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for CXCL17-EXOSC5 |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:42937128/chr19:41897867) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
CXCL17 | EXOSC5 |
FUNCTION: Chemokine that acts as chemoattractant for monocytes, macrophages and dendritic cells (PubMed:16455961, PubMed:23115081). Plays a role in angiogenesis and possibly in the development of tumors (PubMed:16989774, PubMed:23115081). Acts as an anti-inflammatory in the stomach (PubMed:23115081). May play a role in the innate defense against infections (PubMed:17307946). Activates the C-X-C chemokine receptor GPR35 to induce a rapid and transient rise in the level of intracellular calcium ions (PubMed:25411203). {ECO:0000269|PubMed:16455961, ECO:0000269|PubMed:16989774, ECO:0000269|PubMed:17307946, ECO:0000269|PubMed:23115081, ECO:0000269|PubMed:25411203}.; FUNCTION: [4-Cys CXCL17]: seems exhibit much higher chemoattractant potency on monocytes and macrophages than 6-Cys CXCL17. {ECO:0000269|PubMed:23115081}. | FUNCTION: Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. {ECO:0000269|PubMed:11782436, ECO:0000269|PubMed:21255825}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Top |
Fusion Gene Sequence for CXCL17-EXOSC5 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>20830_20830_1_CXCL17-EXOSC5_CXCL17_chr19_42937128_ENST00000601181_EXOSC5_chr19_41897867_ENST00000221233_length(transcript)=1183nt_BP=478nt GATTCCCATAAAGCACATGGTCTAATCTGTTACGTAACAGCAAGACAGCGTCACCTCACCTGTTCTCGCCCTCAAATGGGAACGCTGGCC TGGGACTAAAGCATAGACCACCAGGCTGAGTATCCTGACCTGAGTCATCCCCAGGGATCAGGAGCCTCCAGCAGGGAACCTTCCATTATA TTCTTCAAGCAACTTACAGCTGCACCGACAGTTGCGATGAAAGTTCTAATCTCTTCCCTCCTCCTGTTGCTGCCACTAATGCTGATGTCC ATGGTCTCTAGCAGCCTGAATCCAGGGGTCGCCAGAGGCCACAGGGACCGAGGCCAGGCTTCTAGGAGATGGCTCCAGGAAGGCGGCCAA GAATGTGAGTGCAAAGATTGGTTCCTGAGAGCCCCGAGAAGAAAATTCATGACAGTGTCTGGGCTGCCAAAGAAGCAGTGCCCCTGTGAT CATTTCAAGGGCAATGTGAAGAAAACAAGTGTTGCAGAGAAGAGCCGGGAGCGGCTGATCAGGAACACGTGCGAGGCGGTGGTGCTGGGC ACGTTGCACCCCCGCACCTCCATCACCGTGGTGCTGCAGGTTGTCAGCGATGCCGGCTCTCTCCTGGCCTGTTGTCTGAATGCCGCCTGC ATGGCATTGGTGGATGCAGGTGTGCCCATGCGGGCTCTCTTCTGTGGGGTCGCCTGCGCCCTGGACTCTGATGGGACCCTCGTGCTGGAT CCTACATCCAAGCAAGAAAAGGAGGCCCGGGCAGTCCTGACCTTTGCCCTGGACAGCGTGGAACGGAAGCTGCTGATGTCCAGCACCAAG GGGCTCTACTCAGACACTGAGCTCCAGCAGTGCCTGGCTGCGGCCCAGGCCGCTTCGCAACACGTCTTCCGTTTCTACCGGGAATCGCTG CAGAGGCGTTACTCCAAGAGCTGAGGCAAGCTGGGGCAAGGGGCCGCTCCCATTGCCTCCACCCACTCACCCCCTACAGCCTGAAGCAAA CCAGCAGCCCAGCCTTGCCTCTCTGACCCATGGGCTCCTTGAGCCTGCAGCTCTGTAACCACAGGGCTCCTGTGGGGAGGCCTTGGCCTG TGACAGCCCCCAGGCCTGGGGGCACAGATCCCCCCAGCAAGGATAACATTCAAAGGAGCTCACATTTATGGAATGGATGAATCAATAAAT >20830_20830_1_CXCL17-EXOSC5_CXCL17_chr19_42937128_ENST00000601181_EXOSC5_chr19_41897867_ENST00000221233_length(amino acids)=264AA_BP=18 MSHPQGSGASSREPSIIFFKQLTAAPTVAMKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPR RKFMTVSGLPKKQCPCDHFKGNVKKTSVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPMRAL -------------------------------------------------------------- >20830_20830_2_CXCL17-EXOSC5_CXCL17_chr19_42937128_ENST00000601181_EXOSC5_chr19_41897867_ENST00000596905_length(transcript)=1142nt_BP=478nt GATTCCCATAAAGCACATGGTCTAATCTGTTACGTAACAGCAAGACAGCGTCACCTCACCTGTTCTCGCCCTCAAATGGGAACGCTGGCC TGGGACTAAAGCATAGACCACCAGGCTGAGTATCCTGACCTGAGTCATCCCCAGGGATCAGGAGCCTCCAGCAGGGAACCTTCCATTATA TTCTTCAAGCAACTTACAGCTGCACCGACAGTTGCGATGAAAGTTCTAATCTCTTCCCTCCTCCTGTTGCTGCCACTAATGCTGATGTCC ATGGTCTCTAGCAGCCTGAATCCAGGGGTCGCCAGAGGCCACAGGGACCGAGGCCAGGCTTCTAGGAGATGGCTCCAGGAAGGCGGCCAA GAATGTGAGTGCAAAGATTGGTTCCTGAGAGCCCCGAGAAGAAAATTCATGACAGTGTCTGGGCTGCCAAAGAAGCAGTGCCCCTGTGAT CATTTCAAGGGCAATGTGAAGAAAACAAGTGTTGCAGAGAAGAGCCGGGAGCGGCTGATCAGGAACACGTGCGAGGCGGTGGTGCTGGGC ACGTTGCACCCCCGCACCTCCATCACCGTGGTGCTGCAGGTTGTCAGCGATGCCGGCTCTCTCCTGGCCTGTTGTCTGAATGCCGCCTGC ATGGCATTGGTGGATGCAGGTGTGCCCATGCGGGCTCTCTTCTGTGGGGTCGCCTGCGCCCTGGACTCTGATGGGACCCTCGTGCTGGAT CCTACATCCAAGCAAGAAAAGGAGGCCCGGGCAGTCCTGACCTTTGCCCTGGACAGCGTGGAACGGAAGCTGCTGATGTCCAGCACCAAG GGGCTCTACTCAGACACTGAGCTCCAGCAGTGCCTGGCTGCGGCCCAGGCCGCTTCGCAACACGTCTTCCGTTTCTACCGGGAATCGCTG CAGAGGCGTTACTCCAAGAGCTGAGGCAAGCTGGGGCAAGGGGCCGCTCCCATTGCCTCCACCCACTCACCCCCTACAGCCTGAAGCAAA CCAGCAGCCCAGCCTTGCCTCTCTGACCCATGGGCTCCTTGAGCCTGCAGCTCTGTAACCACAGGGCTCCTGTGGGGAGGCCTTGGCCTG >20830_20830_2_CXCL17-EXOSC5_CXCL17_chr19_42937128_ENST00000601181_EXOSC5_chr19_41897867_ENST00000596905_length(amino acids)=264AA_BP=18 MSHPQGSGASSREPSIIFFKQLTAAPTVAMKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPR RKFMTVSGLPKKQCPCDHFKGNVKKTSVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPMRAL -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for CXCL17-EXOSC5 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for CXCL17-EXOSC5 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for CXCL17-EXOSC5 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |