|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:DAB2IP-TGM2 (FusionGDB2 ID:21238) |
Fusion Gene Summary for DAB2IP-TGM2 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: DAB2IP-TGM2 | Fusion gene ID: 21238 | Hgene | Tgene | Gene symbol | DAB2IP | TGM2 | Gene ID | 153090 | 7052 |
| Gene name | DAB2 interacting protein | transglutaminase 2 | |
| Synonyms | AF9Q34|AIP-1|AIP1|DIP1/2 | TG(C)|TGC | |
| Cytomap | 9q33.2 | 20q11.23 | |
| Type of gene | protein-coding | protein-coding | |
| Description | disabled homolog 2-interacting proteinASK-interacting protein 1ASK1-interacting protein 1DAB2 interaction proteinDOC-2/DAB2 interactive proteinnGAP-like protein | protein-glutamine gamma-glutamyltransferase 2C polypeptide, protein-glutamine-gamma-glutamyltransferaseTGase CTGase HTGase-2tissue transglutaminasetransglutaminase Ctransglutaminase H | |
| Modification date | 20200313 | 20200320 | |
| UniProtAcc | Q5VWQ8 | . | |
| Ensembl transtripts involved in fusion gene | ENST00000408936, ENST00000259371, ENST00000309989, ENST00000487716, | ENST00000361475, ENST00000536701, ENST00000536724, | |
| Fusion gene scores | * DoF score | 12 X 10 X 8=960 | 9 X 11 X 5=495 |
| # samples | 12 | 11 | |
| ** MAII score | log2(12/960*10)=-3 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(11/495*10)=-2.16992500144231 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: DAB2IP [Title/Abstract] AND TGM2 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | DAB2IP(124414178)-TGM2(36760902), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | |||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | DAB2IP | GO:0000122 | negative regulation of transcription by RNA polymerase II | 15310755 |
| Hgene | DAB2IP | GO:0000185 | activation of MAPKKK activity | 19903888 |
| Hgene | DAB2IP | GO:0007257 | activation of JUN kinase activity | 12813029 |
| Hgene | DAB2IP | GO:0008285 | negative regulation of cell proliferation | 19903888 |
| Hgene | DAB2IP | GO:0010719 | negative regulation of epithelial to mesenchymal transition | 20154697 |
| Hgene | DAB2IP | GO:0014067 | negative regulation of phosphatidylinositol 3-kinase signaling | 19903888 |
| Hgene | DAB2IP | GO:0016525 | negative regulation of angiogenesis | 19033661 |
| Hgene | DAB2IP | GO:0031334 | positive regulation of protein complex assembly | 18281285 |
| Hgene | DAB2IP | GO:0034144 | negative regulation of toll-like receptor 4 signaling pathway | 19948740 |
| Hgene | DAB2IP | GO:0035924 | cellular response to vascular endothelial growth factor stimulus | 19033661 |
| Hgene | DAB2IP | GO:0043065 | positive regulation of apoptotic process | 17389591|19903888 |
| Hgene | DAB2IP | GO:0043124 | negative regulation of I-kappaB kinase/NF-kappaB signaling | 15310755|17389591 |
| Hgene | DAB2IP | GO:0043254 | regulation of protein complex assembly | 19948740 |
| Hgene | DAB2IP | GO:0043407 | negative regulation of MAP kinase activity | 12813029 |
| Hgene | DAB2IP | GO:0043410 | positive regulation of MAPK cascade | 19903888 |
| Hgene | DAB2IP | GO:0043507 | positive regulation of JUN kinase activity | 15310755 |
| Hgene | DAB2IP | GO:0043553 | negative regulation of phosphatidylinositol 3-kinase activity | 19903888 |
| Hgene | DAB2IP | GO:0044257 | cellular protein catabolic process | 17389591 |
| Hgene | DAB2IP | GO:0045944 | positive regulation of transcription by RNA polymerase II | 15310755|17389591 |
| Hgene | DAB2IP | GO:0046330 | positive regulation of JNK cascade | 17389591|19903888 |
| Hgene | DAB2IP | GO:0070317 | negative regulation of G0 to G1 transition | 19903888 |
| Hgene | DAB2IP | GO:0070373 | negative regulation of ERK1 and ERK2 cascade | 19903888 |
| Hgene | DAB2IP | GO:0071158 | positive regulation of cell cycle arrest | 19903888 |
| Hgene | DAB2IP | GO:0071222 | cellular response to lipopolysaccharide | 19948740 |
| Hgene | DAB2IP | GO:0071347 | cellular response to interleukin-1 | 19948740 |
| Hgene | DAB2IP | GO:0071356 | cellular response to tumor necrosis factor | 12813029|15310755|17389591 |
| Hgene | DAB2IP | GO:0071901 | negative regulation of protein serine/threonine kinase activity | 19903888 |
| Hgene | DAB2IP | GO:0071902 | positive regulation of protein serine/threonine kinase activity | 19903888 |
| Hgene | DAB2IP | GO:1903363 | negative regulation of cellular protein catabolic process | 19903888 |
| Hgene | DAB2IP | GO:2001235 | positive regulation of apoptotic signaling pathway | 19903888 |
| Tgene | TGM2 | GO:0018149 | peptide cross-linking | 30458214 |
| Tgene | TGM2 | GO:0043277 | apoptotic cell clearance | 19628791 |
| Fusion gene breakpoints across DAB2IP (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across TGM2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | STAD | TCGA-D7-5577-01A | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
Top |
Fusion Gene ORF analysis for DAB2IP-TGM2 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| In-frame | ENST00000408936 | ENST00000361475 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
| In-frame | ENST00000408936 | ENST00000536701 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
| In-frame | ENST00000408936 | ENST00000536724 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
| intron-3CDS | ENST00000259371 | ENST00000361475 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
| intron-3CDS | ENST00000259371 | ENST00000536701 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
| intron-3CDS | ENST00000259371 | ENST00000536724 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
| intron-3CDS | ENST00000309989 | ENST00000361475 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
| intron-3CDS | ENST00000309989 | ENST00000536701 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
| intron-3CDS | ENST00000309989 | ENST00000536724 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
| intron-3CDS | ENST00000487716 | ENST00000361475 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
| intron-3CDS | ENST00000487716 | ENST00000536701 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
| intron-3CDS | ENST00000487716 | ENST00000536724 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000408936 | DAB2IP | chr9 | 124414178 | + | ENST00000361475 | TGM2 | chr20 | 36760902 | - | 2513 | 306 | 1084 | 2 | 361 |
| ENST00000408936 | DAB2IP | chr9 | 124414178 | + | ENST00000536701 | TGM2 | chr20 | 36760902 | - | 1019 | 306 | 910 | 2 | 303 |
| ENST00000408936 | DAB2IP | chr9 | 124414178 | + | ENST00000536724 | TGM2 | chr20 | 36760902 | - | 840 | 306 | 589 | 2 | 196 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000408936 | ENST00000361475 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - | 0.02036783 | 0.9796322 |
| ENST00000408936 | ENST00000536701 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - | 0.023570485 | 0.97642946 |
| ENST00000408936 | ENST00000536724 | DAB2IP | chr9 | 124414178 | + | TGM2 | chr20 | 36760902 | - | 0.012006791 | 0.98799324 |
Top |
Fusion Genomic Features for DAB2IP-TGM2 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for DAB2IP-TGM2 |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:124414178/chr20:36760902) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| DAB2IP | . |
| FUNCTION: Functions as a scaffold protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Involved in several processes such as innate immune response, inflammation and cell growth inhibition, apoptosis, cell survival, angiogenesis, cell migration and maturation. Plays also a role in cell cycle checkpoint control; reduces G1 phase cyclin levels resulting in G0/G1 cell cycle arrest. Mediates signal transduction by receptor-mediated inflammatory signals, such as the tumor necrosis factor (TNF), interferon (IFN) or lipopolysaccharide (LPS). Modulates the balance between phosphatidylinositol 3-kinase (PI3K)-AKT-mediated cell survival and apoptosis stimulated kinase (MAP3K5)-JNK signaling pathways; sequesters both AKT1 and MAP3K5 and counterbalances the activity of each kinase by modulating their phosphorylation status in response to proinflammatory stimuli. Acts as a regulator of the endoplasmic reticulum (ER) unfolded protein response (UPR) pathway; specifically involved in transduction of the ER stress-response to the JNK cascade through ERN1. Mediates TNF-alpha-induced apoptosis activation by facilitating dissociation of inhibitor 14-3-3 from MAP3K5; recruits the PP2A phosphatase complex which dephosphorylates MAP3K5 on 'Ser-966', leading to the dissociation of 13-3-3 proteins and activation of the MAP3K5-JNK signaling pathway in endothelial cells. Mediates also TNF/TRAF2-induced MAP3K5-JNK activation, while it inhibits CHUK-NF-kappa-B signaling. Acts a negative regulator in the IFN-gamma-mediated JAK-STAT signaling cascade by inhibiting smooth muscle cell (VSMCs) proliferation and intimal expansion, and thus, prevents graft arteriosclerosis (GA). Acts as a GTPase-activating protein (GAP) for the ADP ribosylation factor 6 (ARF6) and Ras. Promotes hydrolysis of the ARF6-bound GTP and thus, negatively regulates phosphatidylinositol 4,5-bisphosphate (PIP2)-dependent TLR4-TIRAP-MyD88 and NF-kappa-B signaling pathways in endothelial cells in response to lipopolysaccharides (LPS). Binds specifically to phosphatidylinositol 4-phosphate (PtdIns4P) and phosphatidylinositol 3-phosphate (PtdIns3P). In response to vascular endothelial growth factor (VEGFA), acts as a negative regulator of the VEGFR2-PI3K-mediated angiogenic signaling pathway by inhibiting endothelial cell migration and tube formation. In the developing brain, promotes both the transition from the multipolar to the bipolar stage and the radial migration of cortical neurons from the ventricular zone toward the superficial layer of the neocortex in a glial-dependent locomotion process. Probable downstream effector of the Reelin signaling pathway; promotes Purkinje cell (PC) dendrites development and formation of cerebellar synapses. Functions also as a tumor suppressor protein in prostate cancer progression; prevents cell proliferation and epithelial-to-mesenchymal transition (EMT) through activation of the glycogen synthase kinase-3 beta (GSK3B)-induced beta-catenin and inhibition of PI3K-AKT and Ras-MAPK survival downstream signaling cascades, respectively. {ECO:0000269|PubMed:12813029, ECO:0000269|PubMed:17389591, ECO:0000269|PubMed:18292600, ECO:0000269|PubMed:19033661, ECO:0000269|PubMed:19903888, ECO:0000269|PubMed:19948740, ECO:0000269|PubMed:20080667, ECO:0000269|PubMed:20154697, ECO:0000269|PubMed:21700930, ECO:0000269|PubMed:22696229}. | FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | TGM2 | chr9:124414178 | chr20:36760902 | ENST00000361475 | 9 | 13 | 580_583 | 538 | 688.0 | Nucleotide binding | GTP |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000259371 | + | 1 | 17 | 1026_1159 | 0 | 1133.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000309989 | + | 1 | 14 | 1026_1159 | 0 | 1066.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000408936 | + | 1 | 16 | 1026_1159 | 41 | 1190.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000259371 | + | 1 | 17 | 112_117 | 0 | 1133.0 | Compositional bias | Note=Poly-Ala |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000259371 | + | 1 | 17 | 867_870 | 0 | 1133.0 | Compositional bias | Note=Poly-Ala |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000259371 | + | 1 | 17 | 8_52 | 0 | 1133.0 | Compositional bias | Note=Arg-rich |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000259371 | + | 1 | 17 | 903_948 | 0 | 1133.0 | Compositional bias | Note=Pro-rich |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000309989 | + | 1 | 14 | 112_117 | 0 | 1066.0 | Compositional bias | Note=Poly-Ala |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000309989 | + | 1 | 14 | 867_870 | 0 | 1066.0 | Compositional bias | Note=Poly-Ala |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000309989 | + | 1 | 14 | 8_52 | 0 | 1066.0 | Compositional bias | Note=Arg-rich |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000309989 | + | 1 | 14 | 903_948 | 0 | 1066.0 | Compositional bias | Note=Pro-rich |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000408936 | + | 1 | 16 | 112_117 | 41 | 1190.0 | Compositional bias | Note=Poly-Ala |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000408936 | + | 1 | 16 | 867_870 | 41 | 1190.0 | Compositional bias | Note=Poly-Ala |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000408936 | + | 1 | 16 | 8_52 | 41 | 1190.0 | Compositional bias | Note=Arg-rich |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000408936 | + | 1 | 16 | 903_948 | 41 | 1190.0 | Compositional bias | Note=Pro-rich |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000259371 | + | 1 | 17 | 101_202 | 0 | 1133.0 | Domain | PH |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000259371 | + | 1 | 17 | 193_311 | 0 | 1133.0 | Domain | C2 |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000259371 | + | 1 | 17 | 371_563 | 0 | 1133.0 | Domain | Ras-GAP |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000309989 | + | 1 | 14 | 101_202 | 0 | 1066.0 | Domain | PH |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000309989 | + | 1 | 14 | 193_311 | 0 | 1066.0 | Domain | C2 |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000309989 | + | 1 | 14 | 371_563 | 0 | 1066.0 | Domain | Ras-GAP |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000408936 | + | 1 | 16 | 101_202 | 41 | 1190.0 | Domain | PH |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000408936 | + | 1 | 16 | 193_311 | 41 | 1190.0 | Domain | C2 |
| Hgene | DAB2IP | chr9:124414178 | chr20:36760902 | ENST00000408936 | + | 1 | 16 | 371_563 | 41 | 1190.0 | Domain | Ras-GAP |
| Tgene | TGM2 | chr9:124414178 | chr20:36760902 | ENST00000361475 | 9 | 13 | 476_483 | 538 | 688.0 | Nucleotide binding | GTP |
Top |
Fusion Gene Sequence for DAB2IP-TGM2 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >21238_21238_1_DAB2IP-TGM2_DAB2IP_chr9_124414178_ENST00000408936_TGM2_chr20_36760902_ENST00000361475_length(transcript)=2513nt_BP=306nt GGGAGCGGGAGGGGGCAGGAGGCGGAGGAGGAGTTTGAGCGACTTTGTGGGGCAGCCAGGGCCTCGGCGGCCGCTCGGGCGAGCGCGGGA GAACGCGTGGGCGCCCGCCGGGCTGTCCGGAGCGGCCGATGGGGCCCGTGTGAGCGCGCCCAGGCCCGGCCCGGTGCCCGGCGGGCGGCA GCATGTCCGCGGGCGGCAGCGCCAGGAAGAGCACCGGGAGGTCCTCCTACTACTACCGGCTGCTGAGGCGGCCCCGGCTGCAGCGACAGA GGAGCCGCTCCCGCAGCCGGACCCGGCCTGCCAGGGAGAAGAGCGTTCCTCTTTGCATCCTCTATGAGAAATACCGTGACTGCCTTACGG AGTCCAACCTCATCAAGGTGCGGGCCCTCCTCGTGGAGCCAGTTATCAACAGCTACCTGCTGGCTGAGAGGGACCTCTACCTGGAGAATC CAGAAATCAAGATCCGGATCCTTGGGGAGCCCAAGCAGAAACGCAAGCTGGTGGCTGAGGTGTCCCTGCAGAACCCGCTCCCTGTGGCCC TGGAAGGCTGCACCTTCACTGTGGAGGGGGCCGGCCTGACTGAGGAGCAGAAGACGGTGGAGATCCCAGACCCCGTGGAGGCAGGGGAGG AAGTTAAGGTGAGAATGGACCTGCTGCCGCTCCACATGGGCCTCCACAAGCTGGTGGTGAACTTCGAGAGCGACAAGCTGAAGGCTGTGA AGGGCTTCCGGAATGTCATCATTGGCCCCGCCTAAGGGACCCCTGCTCCCAGCCTGCTGAGAGCCCCCACCTTGATCCCAATCCTTATCC CAAGCTAGTGAGCAAAATATGCCCCTTCTTGGGCCCCAGACCCCAGGGCAGGGTGGGCAGCCTATGGGGGCTCTCGGAAATGGAATGTGC CCCTGGCCCATCTCAGCCTCCTGAGCCTGTGGGTCCCCACTCACCCCCTTTGCTGTGAGGAATGCTCTGTGCCAGAAACAGTGGGAGCCC TGACCTTGGCTGACTGGGGCTGGGGTGAGAGAGGAAAGACCTACATTCCCTCTCCTGCCCAGATGCCCTTTGGAAAGCCATTGACCACCC ACCATATTGTTTGATCTACTTCATAGCTCCTTGGAGCAGGCAAAAAAGGGACAGCATGCCCCTTGGCTGGATCAGGGAATCCAGCTCCCT AGACTGCATCCCGTACCTCTTCCCATGACTGCACCCAGCTCCAGGGGCCCTTGGGACAGCCAGAGCTGGGTGGGGACAGTGATAGGCCCA AGGTCCCCTCCACATCCCAGCAGCCCAAGCTTAATAGCCCTCCCCCTCAACCTCACCATTGTGAAGCACCTACTATGTGCTGGGTGCCTC CCACACTTGCTGGGGCTCACGGGGCCTCCAACCCATTTAATCACCATGGGAAACTGTTGTGGGCGCTGCTTCCAGGATAAGGAGACTGAG GCTTAGAGAGAGGAGGCAGCCCCCTCCACACCAGTGGCCTCGTGGTTATTAGCAAGGCTGGGTAATGTGAAGGCCCAAGAGCAGAGTCTG GGCCTCTGACTCTGAGTCCACTGCTCCATTTATAACCCCAGCCTGACCTGAGACTGTCGGAGAGGCTGTCTGGGGCCTTTATCAAAAAAA GACTCAGCCAAGACAAGGAGGTAGAGAGGGGACTGGGGGACTGGGAGTCAGAGCCCTGGCTGGGTTCAGGTCCCACGTCTGGCCAGGCAC TGCCTTCTCCTCTCTGGGCCTTTGTTTCCTTGTTGGTCAGAGGAGTGATTGAACCAGCTCATCTCCAAGGATCCTCTCCACTCCATGTTT GCAATGCTTTTATATGGCCCAGCCTTGTAAATAACCACAAGGTCCACTCCCTGCTCCACGAAGCCTTAAGCCATAGGCCCAGGATATTTC TGAGAGTGAAACCATGACTGTGACCACCTTCTGTCCCCAGCCCTGTCCTGGTTCCTTCCTATGCCCAGGTACCACCCTTCAGACCCCAGT TCTAGGGGAGAAGAGCCCTGGACACCCCTGCTCTACCCATGAGCCTGCCCGCTGCAATGCCTAGACTTCCCAACAGCCTTAGCTGCCAGT GCTGGTCACTAACCAACAAGGTTGGCACCCCAGCTACCCCTTCTTTGCAGGGCTAAGGCCCCCAAACATAGCCCCTGCCCCGGAGGAAGC TTGGGGAACCCATGAGTTGTCAGCTTTGACTTTATCTCCTGCTCTTTCTACATGACTGGGCCTCCCTTGGGCTGGAAGAATTGGGGATTC TCTATTGGAGGTGAGATCACAGCCTCCAGGGCCCCCCAAATCCCAGGGAAGGACTTGGAGAGAATCATGCTGTTGCATTTAGAACTTTCT GCTTTGCACAGGAAAGAGTCACACAATTAATCAACATGTATATTTTCTCTATACATAGAGCTCTATTTCTCTACGGTTTTATAAAAGCCT >21238_21238_1_DAB2IP-TGM2_DAB2IP_chr9_124414178_ENST00000408936_TGM2_chr20_36760902_ENST00000361475_length(amino acids)=361AA_BP=0 MVGGQWLSKGHLGRRGNVGLSSLTPAPVSQGQGSHCFWHRAFLTAKGVSGDPQAQEAEMGQGHIPFPRAPIGCPPCPGVWGPRRGIFCSL AWDKDWDQGGGSQQAGSRGPLGGANDDIPEALHSLQLVALEVHHQLVEAHVERQQVHSHLNFLPCLHGVWDLHRLLLLSQAGPLHSEGAA FQGHRERVLQGHLSHQLAFLLGLPKDPDLDFWILQVEVPLSQQVAVDNWLHEEGPHLDEVGLRKAVTVFLIEDAKRNALLPGRPGPAAGA APLSLQPGPPQQPVVVGGPPGALPGAAARGHAAARRAPGRAWARSHGPHRPLRTARRAPTRSPALARAAAEALAAPQSRSNSSSASCPLP -------------------------------------------------------------- >21238_21238_2_DAB2IP-TGM2_DAB2IP_chr9_124414178_ENST00000408936_TGM2_chr20_36760902_ENST00000536701_length(transcript)=1019nt_BP=306nt GGGAGCGGGAGGGGGCAGGAGGCGGAGGAGGAGTTTGAGCGACTTTGTGGGGCAGCCAGGGCCTCGGCGGCCGCTCGGGCGAGCGCGGGA GAACGCGTGGGCGCCCGCCGGGCTGTCCGGAGCGGCCGATGGGGCCCGTGTGAGCGCGCCCAGGCCCGGCCCGGTGCCCGGCGGGCGGCA GCATGTCCGCGGGCGGCAGCGCCAGGAAGAGCACCGGGAGGTCCTCCTACTACTACCGGCTGCTGAGGCGGCCCCGGCTGCAGCGACAGA GGAGCCGCTCCCGCAGCCGGACCCGGCCTGCCAGGGAGAAGAGCGTTCCTCTTTGCATCCTCTATGAGAAATACCGTGACTGCCTTACGG AGTCCAACCTCATCAAGGTGCGGGCCCTCCTCGTGGAGCCAGTTATCAACAGCTACCTGCTGGCTGAGAGGGACCTCTACCTGGAGAATC CAGAAATCAAGATCCGGATCCTTGGGGAGCCCAAGCAGAAACGCAAGCTGGTGGCTGAGGTGTCCCTGCAGAACCCGCTCCCTGTGGCCC TGGAAGGCTGCACCTTCACTGTGGAGGGGGCCGGCCTGACTGAGGAGCAGAAGACGGTGGAGATCCCAGACCCCGTGGAGGCAGGGGAGG AAGTTAAGGTGAGAATGGACCTGCTGCCGCTCCACATGGGCCTCCACAAGCTGGTGGTGAACTTCGAGAGCGACAAGCTGAAGGCTGTGA AGGGCTTCCGGAATGTCATCATTGGCCCCGCCTAAGGGACCCCTGCTCCCAGCCTGCTGAGAGCCCCCACCTTGATCCCAATCCTTATCC CAAGCTAGTGAGCAAAATATGCCCCTTCTTGGGCCCCAGACCCCAGGGCAGGGTGGGCAGCCTATGGGGGCTCTCGGAAATGGAATGTGC CCCTGGCCCATCTCAGCCTCCTGAGCCTGTGGGTCCCCACTCACCCCCTTTGCTGTGAGGAATGCTCTGTGCCAGAAACAGTGGGAGCCC >21238_21238_2_DAB2IP-TGM2_DAB2IP_chr9_124414178_ENST00000408936_TGM2_chr20_36760902_ENST00000536701_length(amino acids)=303AA_BP=0 MGQGHIPFPRAPIGCPPCPGVWGPRRGIFCSLAWDKDWDQGGGSQQAGSRGPLGGANDDIPEALHSLQLVALEVHHQLVEAHVERQQVHS HLNFLPCLHGVWDLHRLLLLSQAGPLHSEGAAFQGHRERVLQGHLSHQLAFLLGLPKDPDLDFWILQVEVPLSQQVAVDNWLHEEGPHLD EVGLRKAVTVFLIEDAKRNALLPGRPGPAAGAAPLSLQPGPPQQPVVVGGPPGALPGAAARGHAAARRAPGRAWARSHGPHRPLRTARRA -------------------------------------------------------------- >21238_21238_3_DAB2IP-TGM2_DAB2IP_chr9_124414178_ENST00000408936_TGM2_chr20_36760902_ENST00000536724_length(transcript)=840nt_BP=306nt GGGAGCGGGAGGGGGCAGGAGGCGGAGGAGGAGTTTGAGCGACTTTGTGGGGCAGCCAGGGCCTCGGCGGCCGCTCGGGCGAGCGCGGGA GAACGCGTGGGCGCCCGCCGGGCTGTCCGGAGCGGCCGATGGGGCCCGTGTGAGCGCGCCCAGGCCCGGCCCGGTGCCCGGCGGGCGGCA GCATGTCCGCGGGCGGCAGCGCCAGGAAGAGCACCGGGAGGTCCTCCTACTACTACCGGCTGCTGAGGCGGCCCCGGCTGCAGCGACAGA GGAGCCGCTCCCGCAGCCGGACCCGGCCTGCCAGGGAGAAGAGCGTTCCTCTTTGCATCCTCTATGAGAAATACCGTGACTGCCTTACGG AGTCCAACCTCATCAAGGTGCGGGCCCTCCTCGTGGAGCCAGTTATCAACAGCTACCTGCTGGCTGAGAGGGACCTCTACCTGGAGAATC CAGAAATCAAGATCCGGATCCTTGGGGAGCCCAAGCAGAAACGCAAGCTGGTGGCTGAGGTGTCCCTGCAGAACCCGCTCCCTGTGGCCC TGGAAGGCTGCACCTTCACTGTGGAGGGGGCCGGCCTGACTGAGGAGCAGAAGACGGTGGAGATCCCAGACCCCGTGGAGGCAGGGGAGG AAGTTAAGGTGAGAATGGACCTGCTGCCGCTCCACATGGGCCTCCACAAGCTGGTGGTGAACTTCGAGAGCGACAAGCTGAAGGCTGTGA AGGGCTTCCGGAATGTCATCATTGGCCCCGCCTAAGGGACCCCTGCTCCCAGCCTGCTGAGAGCCCCCACCTTGATCCCAATCCTTATCC >21238_21238_3_DAB2IP-TGM2_DAB2IP_chr9_124414178_ENST00000408936_TGM2_chr20_36760902_ENST00000536724_length(amino acids)=196AA_BP=1 MLLSQAGPLHSEGAAFQGHRERVLQGHLSHQLAFLLGLPKDPDLDFWILQVEVPLSQQVAVDNWLHEEGPHLDEVGLRKAVTVFLIEDAK RNALLPGRPGPAAGAAPLSLQPGPPQQPVVVGGPPGALPGAAARGHAAARRAPGRAWARSHGPHRPLRTARRAPTRSPALARAAAEALAA -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for DAB2IP-TGM2 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for DAB2IP-TGM2 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for DAB2IP-TGM2 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies