|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:ADAR-SUMO3 (FusionGDB2 ID:2181) |
Fusion Gene Summary for ADAR-SUMO3 |
Fusion gene summary |
Fusion gene information | Fusion gene name: ADAR-SUMO3 | Fusion gene ID: 2181 | Hgene | Tgene | Gene symbol | ADAR | SUMO3 | Gene ID | 103 | 6613 |
Gene name | adenosine deaminase RNA specific | small ubiquitin like modifier 2 | |
Synonyms | ADAR1|AGS6|DRADA|DSH|DSRAD|G1P1|IFI-4|IFI4|K88DSRBP|P136 | HSMT3|SMT3B|SMT3H2|SUMO3|Smt3A | |
Cytomap | 1q21.3 | 17q25.1 | |
Type of gene | protein-coding | protein-coding | |
Description | double-stranded RNA-specific adenosine deaminase136 kDa double-stranded RNA-binding proteinadenosine deaminase acting on RNA 1-AdsRNA adenosine deaminasedsRNA adeonosine deaminaseinterferon-induced protein 4interferon-inducible protein 4 | small ubiquitin-related modifier 2SMT3 homolog 2SMT3 suppressor of mif two 3 homolog 2sentrin 2ubiquitin-like protein SMT3Aubiquitin-like protein SMT3B | |
Modification date | 20200320 | 20200322 | |
UniProtAcc | P55265 | . | |
Ensembl transtripts involved in fusion gene | ENST00000292205, ENST00000368471, ENST00000368474, ENST00000471068, | ENST00000397893, ENST00000411651, ENST00000479153, ENST00000332859, ENST00000397898, | |
Fusion gene scores | * DoF score | 9 X 10 X 7=630 | 6 X 6 X 3=108 |
# samples | 10 | 6 | |
** MAII score | log2(10/630*10)=-2.65535182861255 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/108*10)=-0.84799690655495 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: ADAR [Title/Abstract] AND SUMO3 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | ADAR(154600331)-SUMO3(46229033), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ADAR | GO:0006382 | adenosine to inosine editing | 15858013|19651874|21289159 |
Hgene | ADAR | GO:0016553 | base conversion or substitution editing | 9020165 |
Hgene | ADAR | GO:0031054 | pre-miRNA processing | 23622242 |
Hgene | ADAR | GO:0035280 | miRNA loading onto RISC involved in gene silencing by miRNA | 23622242 |
Hgene | ADAR | GO:0035455 | response to interferon-alpha | 16475990 |
Hgene | ADAR | GO:0044387 | negative regulation of protein kinase activity by regulation of protein phosphorylation | 19651874 |
Hgene | ADAR | GO:0045070 | positive regulation of viral genome replication | 19651874 |
Tgene | SUMO3 | GO:0016925 | protein sumoylation | 17081986|17696781|21965678|24105744 |
Tgene | SUMO3 | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process | 18408734 |
Fusion gene breakpoints across ADAR (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across SUMO3 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | SARC | TCGA-3B-A9HO-01A | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
Top |
Fusion Gene ORF analysis for ADAR-SUMO3 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-5UTR | ENST00000292205 | ENST00000397893 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
5CDS-5UTR | ENST00000292205 | ENST00000411651 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
5CDS-5UTR | ENST00000292205 | ENST00000479153 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
5UTR-3CDS | ENST00000368471 | ENST00000332859 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
5UTR-3CDS | ENST00000368471 | ENST00000397898 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
5UTR-5UTR | ENST00000368471 | ENST00000397893 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
5UTR-5UTR | ENST00000368471 | ENST00000411651 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
5UTR-5UTR | ENST00000368471 | ENST00000479153 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
In-frame | ENST00000292205 | ENST00000332859 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
In-frame | ENST00000292205 | ENST00000397898 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
intron-3CDS | ENST00000368474 | ENST00000332859 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
intron-3CDS | ENST00000368474 | ENST00000397898 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
intron-3CDS | ENST00000471068 | ENST00000332859 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
intron-3CDS | ENST00000471068 | ENST00000397898 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
intron-5UTR | ENST00000368474 | ENST00000397893 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
intron-5UTR | ENST00000368474 | ENST00000411651 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
intron-5UTR | ENST00000368474 | ENST00000479153 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
intron-5UTR | ENST00000471068 | ENST00000397893 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
intron-5UTR | ENST00000471068 | ENST00000411651 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
intron-5UTR | ENST00000471068 | ENST00000479153 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000292205 | ADAR | chr1 | 154600331 | - | ENST00000397898 | SUMO3 | chr21 | 46229033 | - | 1690 | 144 | 0 | 401 | 133 |
ENST00000292205 | ADAR | chr1 | 154600331 | - | ENST00000332859 | SUMO3 | chr21 | 46229033 | - | 1640 | 144 | 1233 | 874 | 119 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000292205 | ENST00000397898 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - | 0.70256984 | 0.29743022 |
ENST00000292205 | ENST00000332859 | ADAR | chr1 | 154600331 | - | SUMO3 | chr21 | 46229033 | - | 0.25430185 | 0.7456981 |
Top |
Fusion Genomic Features for ADAR-SUMO3 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for ADAR-SUMO3 |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:154600331/chr21:46229033) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
ADAR | . |
FUNCTION: Catalyzes the hydrolytic deamination of adenosine to inosine in double-stranded RNA (dsRNA) referred to as A-to-I RNA editing (PubMed:7972084, PubMed:7565688, PubMed:12618436). This may affect gene expression and function in a number of ways that include mRNA translation by changing codons and hence the amino acid sequence of proteins; pre-mRNA splicing by altering splice site recognition sequences; RNA stability by changing sequences involved in nuclease recognition; genetic stability in the case of RNA virus genomes by changing sequences during viral RNA replication; and RNA structure-dependent activities such as microRNA production or targeting or protein-RNA interactions. Can edit both viral and cellular RNAs and can edit RNAs at multiple sites (hyper-editing) or at specific sites (site-specific editing). Its cellular RNA substrates include: bladder cancer-associated protein (BLCAP), neurotransmitter receptors for glutamate (GRIA2) and serotonin (HTR2C) and GABA receptor (GABRA3). Site-specific RNA editing of transcripts encoding these proteins results in amino acid substitutions which consequently alters their functional activities. Exhibits low-level editing at the GRIA2 Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Its viral RNA substrates include: hepatitis C virus (HCV), vesicular stomatitis virus (VSV), measles virus (MV), hepatitis delta virus (HDV), and human immunodeficiency virus type 1 (HIV-1). Exhibits either a proviral (HDV, MV, VSV and HIV-1) or an antiviral effect (HCV) and this can be editing-dependent (HDV and HCV), editing-independent (VSV and MV) or both (HIV-1). Impairs HCV replication via RNA editing at multiple sites. Enhances the replication of MV, VSV and HIV-1 through an editing-independent mechanism via suppression of EIF2AK2/PKR activation and function. Stimulates both the release and infectivity of HIV-1 viral particles by an editing-dependent mechanism where it associates with viral RNAs and edits adenosines in the 5'UTR and the Rev and Tat coding sequence. Can enhance viral replication of HDV via A-to-I editing at a site designated as amber/W, thereby changing an UAG amber stop codon to an UIG tryptophan (W) codon that permits synthesis of the large delta antigen (L-HDAg) which has a key role in the assembly of viral particles. However, high levels of ADAR1 inhibit HDV replication. {ECO:0000269|PubMed:12618436, ECO:0000269|PubMed:15556947, ECO:0000269|PubMed:15858013, ECO:0000269|PubMed:16120648, ECO:0000269|PubMed:16475990, ECO:0000269|PubMed:17079286, ECO:0000269|PubMed:19605474, ECO:0000269|PubMed:19651874, ECO:0000269|PubMed:19710021, ECO:0000269|PubMed:19908260, ECO:0000269|PubMed:21289159, ECO:0000269|PubMed:22278222, ECO:0000269|PubMed:7565688, ECO:0000269|PubMed:7972084}. | FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368471 | - | 1 | 15 | 133_199 | 0 | 932.0 | Domain | Z-binding 1 |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368471 | - | 1 | 15 | 293_357 | 0 | 932.0 | Domain | Z-binding 2 |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368471 | - | 1 | 15 | 503_571 | 0 | 932.0 | Domain | DRBM 1 |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368471 | - | 1 | 15 | 614_682 | 0 | 932.0 | Domain | DRBM 2 |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368471 | - | 1 | 15 | 726_794 | 0 | 932.0 | Domain | DRBM 3 |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368471 | - | 1 | 15 | 886_1221 | 0 | 932.0 | Domain | A to I editase |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368474 | - | 1 | 15 | 133_199 | 0 | 1227.0 | Domain | Z-binding 1 |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368474 | - | 1 | 15 | 293_357 | 0 | 1227.0 | Domain | Z-binding 2 |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368474 | - | 1 | 15 | 503_571 | 0 | 1227.0 | Domain | DRBM 1 |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368474 | - | 1 | 15 | 614_682 | 0 | 1227.0 | Domain | DRBM 2 |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368474 | - | 1 | 15 | 726_794 | 0 | 1227.0 | Domain | DRBM 3 |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368474 | - | 1 | 15 | 886_1221 | 0 | 1227.0 | Domain | A to I editase |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368471 | - | 1 | 15 | 716_725 | 0 | 932.0 | Region | N-terminal extension of DRBM 3 and constituent of a bi-partite nuclear localization signal |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368471 | - | 1 | 15 | 795_801 | 0 | 932.0 | Region | C-terminal extension of DRBM 3 and constituent of a bi-partite nuclear localization signal |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368474 | - | 1 | 15 | 716_725 | 0 | 1227.0 | Region | N-terminal extension of DRBM 3 and constituent of a bi-partite nuclear localization signal |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368474 | - | 1 | 15 | 795_801 | 0 | 1227.0 | Region | C-terminal extension of DRBM 3 and constituent of a bi-partite nuclear localization signal |
Tgene | SUMO3 | chr1:154600331 | chr21:46229033 | ENST00000332859 | 1 | 4 | 15_92 | 50 | 104.0 | Domain | Ubiquitin-like |
Top |
Fusion Gene Sequence for ADAR-SUMO3 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>2181_2181_1_ADAR-SUMO3_ADAR_chr1_154600331_ENST00000292205_SUMO3_chr21_46229033_ENST00000332859_length(transcript)=1640nt_BP=144nt ATGATGTCACCAATCTGCGACCAGACCATTGATTCCCGACTGAAGGTAGAGAAGGCTACGTGGTGGGGGAGGGTGGGGGGAGGGTCGCGG CCGCACTGGCAGTCTCCGGGTGTCCGGCCGTGTCCCGAGGAAGTGCAAGACCCGGGCTTGTCAATGAGGCAGATCAGATTCAGGTTCGAC GGGCAGCCAATCAATGAAACTGACACTCCAGCACAGCTGGAGATGGAGGACGAGGACACCATCGACGTGTTCCAGCAGCAGACGGGAGGT GTGCCGGAGAGCAGCCTGGCAGGGCACAGTTTCTAGAGGGCCCGTCCCCAGCCCGGGCCGTCCATCCTCGCATTGCTGTTGAATGGTGAG CACGTGACCATGCCGACCACAAAGGTGTCTGCGGAAACTCGAGGACATTCACCACGATGATTTTCCTCTCTTTGATGTACTTCAAGTGCA ACTCAAAACTATATCTGCAGGGATGAATCTGTAACTTAAATTGGGCCAATCAGAATTGTTATCTTTGTTCAGGTAAAATGAGTTGCAAGA TATTGTGGGTACTTTTGTGTGCTCATTTGTGTTTTCCCCCCCTCCTACAACATTTTTTTAACCCCAAAATTATAGCCTGAATGTTCGCTT TTAGTCTGGCCAGGGATCTGACTCCTGAGTTGGTTGCCTCTCCCCTGCTCACTCCAGTCACATAGAGAATTGGTGTTTCCCGCAGTGGGG ATGCAGCTGTTGGACAGGTATTGGGGGCAAGGTTGGTAGGGAGGACAGACTGTCACTTGCTGTTACAGGCACAGGTGATTAAAATGCTAA ATATTGCAAATTTAAGCTTTGTCAGTATATGGAAAAGTTGAAGGGAAAATACTGGAATGCTTCTTCAAAGGTTAAAAAATAACCGAGTCT TTTGGTAATTTGACCCCACGTGCTCTCTGGCCCTCAAGCATGTAACCTCGGGGTCTGAGGCCCAGGACCCACCCCCCTGCCACCCCTCCC ACCCCACTCCCTGCTCAGTACCTGGCGTTGGTACACAGGCAAGGATTGGCACAACCAAAATTGGCCTTTTTCTCCCTCTTAATATTGAAG AAATTCCCACATTTCTCATTTGGTAATGGTGTTGTGGCCTCAGATTTCTTCTAGTATTTGCTTCTGATGAATGATTATGGTCTATACATA AAAAAGTAAGACTAAGTATTGCTGAATTTGCAGTTATGTTGTCGTGTATAAGAGCTACTTCCAAGTGTGGTTACAAATGAACCCATGGAA TGATGACTTCATGTTCTTCTCGTGGGTTTGTGCCGTGCTGCTTTCCAAATAGGTATTGAATTTATGCATTAGTCTGGTGATTTCAGTTCT GTGAAATATTTTGGGATCTATACCAATTAAACATTTTCATAGTTCTGCCTATTGTCCTTCCCTGAGGCTCCATTGCTGCTTGGTGGCCAT TCTCTGCCTTTTTACAGTCACCTGAACAATGACCCATCATCTCTTGCTTGCTTGAAATCTTGCTGAAATGTTCTCATTTCCTGTTTGCTG TATGGGCTCGGGTGGGATGTTTGTTGGCTCTGTTGTGTTTATTCACCAATTTGTACATTATTTGTTGTCCTTTACTACTGTAAACAGTAA >2181_2181_1_ADAR-SUMO3_ADAR_chr1_154600331_ENST00000292205_SUMO3_chr21_46229033_ENST00000332859_length(amino acids)=119AA_BP= MEVALIHDNITANSAILSLTFLCIDHNHSSEANTRRNLRPQHHYQMRNVGISSILRGRKRPILVVPILACVPTPGTEQGVGWEGWQGGGS -------------------------------------------------------------- >2181_2181_2_ADAR-SUMO3_ADAR_chr1_154600331_ENST00000292205_SUMO3_chr21_46229033_ENST00000397898_length(transcript)=1690nt_BP=144nt ATGATGTCACCAATCTGCGACCAGACCATTGATTCCCGACTGAAGGTAGAGAAGGCTACGTGGTGGGGGAGGGTGGGGGGAGGGTCGCGG CCGCACTGGCAGTCTCCGGGTGTCCGGCCGTGTCCCGAGGAAGTGCAAGACCCGGGCTTGTCAATGAGGCAGATCAGATTCAGGTTCGAC GGGCAGCCAATCAATGAAACTGACACTCCAGCACAGGTACGGAGCTGGCTTCGCGTGGTTCCAGGGCGACTTCCGATTTGTGCGGGCTGG AGATGGAGGACGAGGACACCATCGACGTGTTCCAGCAGCAGACGGGAGGTGTGCCGGAGAGCAGCCTGGCAGGGCACAGTTTCTAGAGGG CCCGTCCCCAGCCCGGGCCGTCCATCCTCGCATTGCTGTTGAATGGTGAGCACGTGACCATGCCGACCACAAAGGTGTCTGCGGAAACTC GAGGACATTCACCACGATGATTTTCCTCTCTTTGATGTACTTCAAGTGCAACTCAAAACTATATCTGCAGGGATGAATCTGTAACTTAAA TTGGGCCAATCAGAATTGTTATCTTTGTTCAGGTAAAATGAGTTGCAAGATATTGTGGGTACTTTTGTGTGCTCATTTGTGTTTTCCCCC CCTCCTACAACATTTTTTTAACCCCAAAATTATAGCCTGAATGTTCGCTTTTAGTCTGGCCAGGGATCTGACTCCTGAGTTGGTTGCCTC TCCCCTGCTCACTCCAGTCACATAGAGAATTGGTGTTTCCCGCAGTGGGGATGCAGCTGTTGGACAGGTATTGGGGGCAAGGTTGGTAGG GAGGACAGACTGTCACTTGCTGTTACAGGCACAGGTGATTAAAATGCTAAATATTGCAAATTTAAGCTTTGTCAGTATATGGAAAAGTTG AAGGGAAAATACTGGAATGCTTCTTCAAAGGTTAAAAAATAACCGAGTCTTTTGGTAATTTGACCCCACGTGCTCTCTGGCCCTCAAGCA TGTAACCTCGGGGTCTGAGGCCCAGGACCCACCCCCCTGCCACCCCTCCCACCCCACTCCCTGCTCAGTACCTGGCGTTGGTACACAGGC AAGGATTGGCACAACCAAAATTGGCCTTTTTCTCCCTCTTAATATTGAAGAAATTCCCACATTTCTCATTTGGTAATGGTGTTGTGGCCT CAGATTTCTTCTAGTATTTGCTTCTGATGAATGATTATGGTCTATACATAAAAAAGTAAGACTAAGTATTGCTGAATTTGCAGTTATGTT GTCGTGTATAAGAGCTACTTCCAAGTGTGGTTACAAATGAACCCATGGAATGATGACTTCATGTTCTTCTCGTGGGTTTGTGCCGTGCTG CTTTCCAAATAGGTATTGAATTTATGCATTAGTCTGGTGATTTCAGTTCTGTGAAATATTTTGGGATCTATACCAATTAAACATTTTCAT AGTTCTGCCTATTGTCCTTCCCTGAGGCTCCATTGCTGCTTGGTGGCCATTCTCTGCCTTTTTACAGTCACCTGAACAATGACCCATCAT CTCTTGCTTGCTTGAAATCTTGCTGAAATGTTCTCATTTCCTGTTTGCTGTATGGGCTCGGGTGGGATGTTTGTTGGCTCTGTTGTGTTT >2181_2181_2_ADAR-SUMO3_ADAR_chr1_154600331_ENST00000292205_SUMO3_chr21_46229033_ENST00000397898_length(amino acids)=133AA_BP=48 MMSPICDQTIDSRLKVEKATWWGRVGGGSRPHWQSPGVRPCPEEVQDPGLSMRQIRFRFDGQPINETDTPAQVRSWLRVVPGRLPICAGW -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ADAR-SUMO3 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368471 | - | 1 | 15 | 133_202 | 0 | 932.0 | Z-DNA |
Hgene | ADAR | chr1:154600331 | chr21:46229033 | ENST00000368474 | - | 1 | 15 | 133_202 | 0 | 1227.0 | Z-DNA |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ADAR-SUMO3 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for ADAR-SUMO3 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |