|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:EHMT1-NELFB (FusionGDB2 ID:25585) |
Fusion Gene Summary for EHMT1-NELFB |
Fusion gene summary |
Fusion gene information | Fusion gene name: EHMT1-NELFB | Fusion gene ID: 25585 | Hgene | Tgene | Gene symbol | EHMT1 | NELFB | Gene ID | 79813 | 25920 |
Gene name | euchromatic histone lysine methyltransferase 1 | negative elongation factor complex member B | |
Synonyms | EHMT1-IT1|EUHMTASE1|Eu-HMTase1|FP13812|GLP|GLP1|KLEFS1|KMT1D | COBRA1|NELF-B | |
Cytomap | 9q34.3 | 9q34.3 | |
Type of gene | protein-coding | protein-coding | |
Description | histone-lysine N-methyltransferase EHMT1EHMT1 intronic transcript 1G9a-like protein 1H3-K9-HMTase 5euchromatic histone-lysine N-methyltransferase 1histone H3-K9 methyltransferase 5histone-lysine N-methyltransferase, H3 lysine-9 specific 5lysine N-m | negative elongation factor Bcofactor of BRCA1negative elongation factor protein B | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q9H9B1 | Q8WX92 | |
Ensembl transtripts involved in fusion gene | ENST00000371394, ENST00000334856, ENST00000460843, ENST00000462484, | ENST00000343053, | |
Fusion gene scores | * DoF score | 15 X 9 X 8=1080 | 10 X 8 X 4=320 |
# samples | 20 | 10 | |
** MAII score | log2(20/1080*10)=-2.43295940727611 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(10/320*10)=-1.67807190511264 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: EHMT1 [Title/Abstract] AND NELFB [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | EHMT1(140513501)-NELFB(140157489), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | EHMT1 | GO:0006325 | chromatin organization | 12004135 |
Hgene | EHMT1 | GO:0016571 | histone methylation | 12004135 |
Hgene | EHMT1 | GO:0018027 | peptidyl-lysine dimethylation | 20118233 |
Fusion gene breakpoints across EHMT1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across NELFB (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-FP-8631-01A | EHMT1 | chr9 | 140513501 | + | NELFB | chr9 | 140157489 | + |
Top |
Fusion Gene ORF analysis for EHMT1-NELFB |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
3UTR-3CDS | ENST00000371394 | ENST00000343053 | EHMT1 | chr9 | 140513501 | + | NELFB | chr9 | 140157489 | + |
5UTR-3CDS | ENST00000334856 | ENST00000343053 | EHMT1 | chr9 | 140513501 | + | NELFB | chr9 | 140157489 | + |
In-frame | ENST00000460843 | ENST00000343053 | EHMT1 | chr9 | 140513501 | + | NELFB | chr9 | 140157489 | + |
In-frame | ENST00000462484 | ENST00000343053 | EHMT1 | chr9 | 140513501 | + | NELFB | chr9 | 140157489 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000462484 | EHMT1 | chr9 | 140513501 | + | ENST00000343053 | NELFB | chr9 | 140157489 | + | 1822 | 58 | 22 | 1203 | 393 |
ENST00000460843 | EHMT1 | chr9 | 140513501 | + | ENST00000343053 | NELFB | chr9 | 140157489 | + | 1812 | 48 | 12 | 1193 | 393 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000462484 | ENST00000343053 | EHMT1 | chr9 | 140513501 | + | NELFB | chr9 | 140157489 | + | 0.011768313 | 0.9882317 |
ENST00000460843 | ENST00000343053 | EHMT1 | chr9 | 140513501 | + | NELFB | chr9 | 140157489 | + | 0.012241725 | 0.9877582 |
Top |
Fusion Genomic Features for EHMT1-NELFB |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
EHMT1 | chr9 | 140513501 | + | NELFB | chr9 | 140157488 | + | 2.41E-14 | 1 |
EHMT1 | chr9 | 140513501 | + | NELFB | chr9 | 140157488 | + | 2.41E-14 | 1 |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for EHMT1-NELFB |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:140513501/chr9:140157489) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
EHMT1 | NELFB |
FUNCTION: Histone methyltransferase that specifically mono- and dimethylates 'Lys-9' of histone H3 (H3K9me1 and H3K9me2, respectively) in euchromatin. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. Also weakly methylates 'Lys-27' of histone H3 (H3K27me). Also required for DNA methylation, the histone methyltransferase activity is not required for DNA methylation, suggesting that these 2 activities function independently. Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. During G0 phase, it probably contributes to silencing of MYC- and E2F-responsive genes, suggesting a role in G0/G1 transition in cell cycle. In addition to the histone methyltransferase activity, also methylates non-histone proteins: mediates dimethylation of 'Lys-373' of p53/TP53. Represses the expression of mitochondrial function-related genes, perhaps by occupying their promoter regions, working in concert with probable chromatin reader BAZ2B (By similarity). {ECO:0000250|UniProtKB:Q5DW34, ECO:0000269|PubMed:12004135, ECO:0000269|PubMed:20118233}. | FUNCTION: Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II (PubMed:12612062). The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex (PubMed:10199401). May be able to induce chromatin unfolding (PubMed:11739404). Essential for early embryogenesis; plays an important role in maintaining the undifferentiated state of embryonic stem cells (ESCs) by preventing unscheduled expression of developmental genes (By similarity). Plays a key role in establishing the responsiveness of stem cells to developmental cues; facilitates plasticity and cell fate commitment in ESCs by establishing the appropriate expression level of signaling molecules (By similarity). Supports the transcription of genes involved in energy metabolism in cardiomyocytes; facilitates the association of transcription initiation factors with the promoters of the metabolism-related genes (By similarity). {ECO:0000250|UniProtKB:Q8C4Y3, ECO:0000269|PubMed:10199401, ECO:0000269|PubMed:11739404, ECO:0000269|PubMed:12612062}.; FUNCTION: (Microbial infection) The NELF complex is involved in HIV-1 latency possibly involving recruitment of PCF11 to paused RNA polymerase II (PubMed:23884411). In vitro, binds weakly to the HIV-1 TAR RNA which is located in the long terminal repeat (LTR) of HIV-1 (PubMed:23884411). {ECO:0000269|PubMed:23884411}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 1292_1295 | 0 | 826.0 | Compositional bias | Note=Poly-Ala |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 406_409 | 0 | 826.0 | Compositional bias | Note=Poly-Glu |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 442_449 | 0 | 826.0 | Compositional bias | Note=Poly-Arg |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 1292_1295 | 7 | 1299.0 | Compositional bias | Note=Poly-Ala |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 406_409 | 7 | 1299.0 | Compositional bias | Note=Poly-Glu |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 442_449 | 7 | 1299.0 | Compositional bias | Note=Poly-Arg |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 1292_1295 | 7 | 809.0 | Compositional bias | Note=Poly-Ala |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 406_409 | 7 | 809.0 | Compositional bias | Note=Poly-Glu |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 442_449 | 7 | 809.0 | Compositional bias | Note=Poly-Arg |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 1060_1123 | 0 | 826.0 | Domain | Pre-SET |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 1126_1243 | 0 | 826.0 | Domain | SET |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 1060_1123 | 7 | 1299.0 | Domain | Pre-SET |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 1126_1243 | 7 | 1299.0 | Domain | SET |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 1060_1123 | 7 | 809.0 | Domain | Pre-SET |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 1126_1243 | 7 | 809.0 | Domain | SET |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 1136_1138 | 0 | 826.0 | Region | Note=S-adenosyl-L-methionine binding |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 1200_1201 | 0 | 826.0 | Region | Note=S-adenosyl-L-methionine binding |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 905_907 | 0 | 826.0 | Region | Note=Histone H3K9me binding |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 1136_1138 | 7 | 1299.0 | Region | Note=S-adenosyl-L-methionine binding |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 1200_1201 | 7 | 1299.0 | Region | Note=S-adenosyl-L-methionine binding |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 905_907 | 7 | 1299.0 | Region | Note=Histone H3K9me binding |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 1136_1138 | 7 | 809.0 | Region | Note=S-adenosyl-L-methionine binding |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 1200_1201 | 7 | 809.0 | Region | Note=S-adenosyl-L-methionine binding |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 905_907 | 7 | 809.0 | Region | Note=Histone H3K9me binding |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 737_766 | 0 | 826.0 | Repeat | Note=ANK 1 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 772_801 | 0 | 826.0 | Repeat | Note=ANK 2 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 805_834 | 0 | 826.0 | Repeat | Note=ANK 3 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 838_868 | 0 | 826.0 | Repeat | Note=ANK 4 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 872_901 | 0 | 826.0 | Repeat | Note=ANK 5 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 905_934 | 0 | 826.0 | Repeat | Note=ANK 6 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 938_967 | 0 | 826.0 | Repeat | Note=ANK 7 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 971_1004 | 0 | 826.0 | Repeat | Note=ANK 8 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 737_766 | 7 | 1299.0 | Repeat | Note=ANK 1 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 772_801 | 7 | 1299.0 | Repeat | Note=ANK 2 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 805_834 | 7 | 1299.0 | Repeat | Note=ANK 3 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 838_868 | 7 | 1299.0 | Repeat | Note=ANK 4 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 872_901 | 7 | 1299.0 | Repeat | Note=ANK 5 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 905_934 | 7 | 1299.0 | Repeat | Note=ANK 6 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 938_967 | 7 | 1299.0 | Repeat | Note=ANK 7 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 971_1004 | 7 | 1299.0 | Repeat | Note=ANK 8 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 737_766 | 7 | 809.0 | Repeat | Note=ANK 1 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 772_801 | 7 | 809.0 | Repeat | Note=ANK 2 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 805_834 | 7 | 809.0 | Repeat | Note=ANK 3 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 838_868 | 7 | 809.0 | Repeat | Note=ANK 4 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 872_901 | 7 | 809.0 | Repeat | Note=ANK 5 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 905_934 | 7 | 809.0 | Repeat | Note=ANK 6 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 938_967 | 7 | 809.0 | Repeat | Note=ANK 7 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 971_1004 | 7 | 809.0 | Repeat | Note=ANK 8 |
Top |
Fusion Gene Sequence for EHMT1-NELFB |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>25585_25585_1_EHMT1-NELFB_EHMT1_chr9_140513501_ENST00000460843_NELFB_chr9_140157489_ENST00000343053_length(transcript)=1812nt_BP=48nt GGCGGGGCCACGCTGCGGGCCCGGGCCATGGCCGCCGCCGATGCCGAGGTGGTGCAGCGGCTGACGCGGATGGTGGGGAAGAACGTGAAG CTGTACGACATGGTGCTGCAGTTTCTGCGCACGCTCTTCCTGCGCACGCGGAATGTGCACTACTGCACGCTGCGGGCTGAGCTGCTCATG TCCCTGCACGACCTGGACGTGGGTGAAATCTGCACCGTGGACCCGTGCCACAAGTTCACCTGGTGCCTGGACGCCTGCATCCGAGAGCGG TTCGTGGACAGCAAGAGGGCGCGGGAGCTGCAGGGGTTTCTCGATGGCGTCAAGAAGGGCCAGGAGCAGGTGCTGGGGGACCTGTCCATG ATCCTGTGTGACCCCTTCGCCATCAACACGCTGGCACTGAGCACAGTCAGGCACCTGCAGGAGCTGGTCGGCCAGGAGACACTGCCCAGG GACAGCCCCGACCTCCTGCTGCTGCTCCGGCTGCTGGCGCTGGGCCAGGGAGCCTGGGACATGATCGACAGCCAGGTCTTCAAGGAGCCC AAGATGGAGGTAGAGCTCATCACCAGGTTCCTCCCGATGCTCATGTCCTTCCTGGTGGATGACTACACTTTCAATGTGGATCAGAAACTT CCGGCTGAGGAGAAAGCCCCAGTCTCATATCCAAACACACTTCCCGAAAGCTTCACTAAGTTTCTGCAGGAGCAGCGCATGGCCTGCGAG GTGGGGCTGTACTACGTCCTGCACATCACCAAGCAGAGGAACAAGAACGCGCTCCTCCGCCTGCTGCCCGGGCTGGTGGAGACCTTTGGC GACTTGGCCTTTGGCGACATCTTCCTCCACCTGCTCACGGGCAACCTTGCGCTGCTGGCCGACGAATTTGCCCTTGAGGACTTCTGCAGC AGCCTCTTCGATGGCTTCTTCCTCACCGCCTCTCCAAGGAAGGAGAACGTGCACCGGCACGCGCTGCGGCTCCTCATTCACCTGCACCCC AGGGTGGCCCCGTCTAAGCTGGAGGCGTTGCAGAAGGCCCTGGAGCCTACAGGCCAGAGCGGAGAGGCAGTGAAGGAGCTTTACTCCCAG CTCGGCGAGAAGCTGGAACAGCTGGATCACCGGAAGCCCAGCCCGGCACAGGCTGCGGAGACGCCGGCCCTGGAGCTGCCCCTCCCCAGC GTGCCCGCCCCTGCCCCGCTCTGAGGGCCCTCCAGACCTGCTCGGGTGCTGGGGCCATGCCGAGTCGCGGCCCTGCTCAGCCGGAAGAGG CTCCCGGACCTGGATGTACAGGGCAGTCTCTCTTCCCGGGGCTATGGCTGGGCCTGTCCTGCCGTCATGGCCCCCTGCTTCCTGCTCCTT GGAGCTGGCTCCCGGACCTTGCCCACCATCCATGCAGTGGCTCCCAGGGCAGAGCCTCTCCTTGTACTTTGGCAGCCATAGAAAGCGTGC TCATTTTCTGTTTTCCTGTGTTAGGAAAAAACCACCTGTTTTCCAAGGGGAGAGGGCGGGGCCTGAGGGTGGGGGCGGGGCCTCTTCATT GGCCCAGCTTGGCGAAAGCGAGGCACACTGCTTACTGCCTTGGGGTTGTGGAGATGGACCCGTGACCTCGTGGAGGCCGTGTGGGGGCAG CAGCCTGGCCTGTGCCATGGTGGGTGTCCTGGGGCCTGTGCGGAGGGAGCCACCTCACCCTGCAGCCCAGTTTGCAGGTGTGGCCTTGTT TCTCCTTGCCCAGCAGTGCTGCCTTCAGCGGCCGTGACGGGGCCAGCTGGACACACGGTGAGATTTTCTCGTATGTAAATAAAAGGCATT >25585_25585_1_EHMT1-NELFB_EHMT1_chr9_140513501_ENST00000460843_NELFB_chr9_140157489_ENST00000343053_length(amino acids)=393AA_BP=12 MRARAMAAADAEVVQRLTRMVGKNVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMSLHDLDVGEICTVDPCHKFTWCLDACIRERFVDS KRARELQGFLDGVKKGQEQVLGDLSMILCDPFAINTLALSTVRHLQELVGQETLPRDSPDLLLLLRLLALGQGAWDMIDSQVFKEPKMEV ELITRFLPMLMSFLVDDYTFNVDQKLPAEEKAPVSYPNTLPESFTKFLQEQRMACEVGLYYVLHITKQRNKNALLRLLPGLVETFGDLAF GDIFLHLLTGNLALLADEFALEDFCSSLFDGFFLTASPRKENVHRHALRLLIHLHPRVAPSKLEALQKALEPTGQSGEAVKELYSQLGEK -------------------------------------------------------------- >25585_25585_2_EHMT1-NELFB_EHMT1_chr9_140513501_ENST00000462484_NELFB_chr9_140157489_ENST00000343053_length(transcript)=1822nt_BP=58nt GCGCGGGAGGGGCGGGGCCACGCTGCGGGCCCGGGCCATGGCCGCCGCCGATGCCGAGGTGGTGCAGCGGCTGACGCGGATGGTGGGGAA GAACGTGAAGCTGTACGACATGGTGCTGCAGTTTCTGCGCACGCTCTTCCTGCGCACGCGGAATGTGCACTACTGCACGCTGCGGGCTGA GCTGCTCATGTCCCTGCACGACCTGGACGTGGGTGAAATCTGCACCGTGGACCCGTGCCACAAGTTCACCTGGTGCCTGGACGCCTGCAT CCGAGAGCGGTTCGTGGACAGCAAGAGGGCGCGGGAGCTGCAGGGGTTTCTCGATGGCGTCAAGAAGGGCCAGGAGCAGGTGCTGGGGGA CCTGTCCATGATCCTGTGTGACCCCTTCGCCATCAACACGCTGGCACTGAGCACAGTCAGGCACCTGCAGGAGCTGGTCGGCCAGGAGAC ACTGCCCAGGGACAGCCCCGACCTCCTGCTGCTGCTCCGGCTGCTGGCGCTGGGCCAGGGAGCCTGGGACATGATCGACAGCCAGGTCTT CAAGGAGCCCAAGATGGAGGTAGAGCTCATCACCAGGTTCCTCCCGATGCTCATGTCCTTCCTGGTGGATGACTACACTTTCAATGTGGA TCAGAAACTTCCGGCTGAGGAGAAAGCCCCAGTCTCATATCCAAACACACTTCCCGAAAGCTTCACTAAGTTTCTGCAGGAGCAGCGCAT GGCCTGCGAGGTGGGGCTGTACTACGTCCTGCACATCACCAAGCAGAGGAACAAGAACGCGCTCCTCCGCCTGCTGCCCGGGCTGGTGGA GACCTTTGGCGACTTGGCCTTTGGCGACATCTTCCTCCACCTGCTCACGGGCAACCTTGCGCTGCTGGCCGACGAATTTGCCCTTGAGGA CTTCTGCAGCAGCCTCTTCGATGGCTTCTTCCTCACCGCCTCTCCAAGGAAGGAGAACGTGCACCGGCACGCGCTGCGGCTCCTCATTCA CCTGCACCCCAGGGTGGCCCCGTCTAAGCTGGAGGCGTTGCAGAAGGCCCTGGAGCCTACAGGCCAGAGCGGAGAGGCAGTGAAGGAGCT TTACTCCCAGCTCGGCGAGAAGCTGGAACAGCTGGATCACCGGAAGCCCAGCCCGGCACAGGCTGCGGAGACGCCGGCCCTGGAGCTGCC CCTCCCCAGCGTGCCCGCCCCTGCCCCGCTCTGAGGGCCCTCCAGACCTGCTCGGGTGCTGGGGCCATGCCGAGTCGCGGCCCTGCTCAG CCGGAAGAGGCTCCCGGACCTGGATGTACAGGGCAGTCTCTCTTCCCGGGGCTATGGCTGGGCCTGTCCTGCCGTCATGGCCCCCTGCTT CCTGCTCCTTGGAGCTGGCTCCCGGACCTTGCCCACCATCCATGCAGTGGCTCCCAGGGCAGAGCCTCTCCTTGTACTTTGGCAGCCATA GAAAGCGTGCTCATTTTCTGTTTTCCTGTGTTAGGAAAAAACCACCTGTTTTCCAAGGGGAGAGGGCGGGGCCTGAGGGTGGGGGCGGGG CCTCTTCATTGGCCCAGCTTGGCGAAAGCGAGGCACACTGCTTACTGCCTTGGGGTTGTGGAGATGGACCCGTGACCTCGTGGAGGCCGT GTGGGGGCAGCAGCCTGGCCTGTGCCATGGTGGGTGTCCTGGGGCCTGTGCGGAGGGAGCCACCTCACCCTGCAGCCCAGTTTGCAGGTG TGGCCTTGTTTCTCCTTGCCCAGCAGTGCTGCCTTCAGCGGCCGTGACGGGGCCAGCTGGACACACGGTGAGATTTTCTCGTATGTAAAT >25585_25585_2_EHMT1-NELFB_EHMT1_chr9_140513501_ENST00000462484_NELFB_chr9_140157489_ENST00000343053_length(amino acids)=393AA_BP=12 MRARAMAAADAEVVQRLTRMVGKNVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMSLHDLDVGEICTVDPCHKFTWCLDACIRERFVDS KRARELQGFLDGVKKGQEQVLGDLSMILCDPFAINTLALSTVRHLQELVGQETLPRDSPDLLLLLRLLALGQGAWDMIDSQVFKEPKMEV ELITRFLPMLMSFLVDDYTFNVDQKLPAEEKAPVSYPNTLPESFTKFLQEQRMACEVGLYYVLHITKQRNKNALLRLLPGLVETFGDLAF GDIFLHLLTGNLALLADEFALEDFCSSLFDGFFLTASPRKENVHRHALRLLIHLHPRVAPSKLEALQKALEPTGQSGEAVKELYSQLGEK -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for EHMT1-NELFB |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 1162_1181 | 0 | 826.0 | histone H3 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000334856 | + | 1 | 17 | 1242_1245 | 0 | 826.0 | histone H3 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 1162_1181 | 7.0 | 1299.0 | histone H3 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000460843 | + | 1 | 27 | 1242_1245 | 7.0 | 1299.0 | histone H3 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 1162_1181 | 7.0 | 809.0 | histone H3 |
Hgene | EHMT1 | chr9:140513501 | chr9:140157489 | ENST00000462484 | + | 1 | 16 | 1242_1245 | 7.0 | 809.0 | histone H3 |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for EHMT1-NELFB |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for EHMT1-NELFB |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |