|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:ERBB4-IDH1 (FusionGDB2 ID:27227) |
Fusion Gene Summary for ERBB4-IDH1 |
Fusion gene summary |
Fusion gene information | Fusion gene name: ERBB4-IDH1 | Fusion gene ID: 27227 | Hgene | Tgene | Gene symbol | ERBB4 | IDH1 | Gene ID | 2066 | 3417 |
Gene name | erb-b2 receptor tyrosine kinase 4 | isocitrate dehydrogenase (NADP(+)) 1 | |
Synonyms | ALS19|HER4|p180erbB4 | HEL-216|HEL-S-26|IDCD|IDH|IDP|IDPC|PICD | |
Cytomap | 2q34 | 2q34 | |
Type of gene | protein-coding | protein-coding | |
Description | receptor tyrosine-protein kinase erbB-4avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4human epidermal growth factor receptor 4proto-oncogene-like protein c-ErbB-4tyrosine kinase-type cell surface receptor HER4v-erb-a erythroblastic | isocitrate dehydrogenase [NADP] cytoplasmicNADP(+)-specific ICDHNADP-dependent isocitrate dehydrogenase, cytosolicNADP-dependent isocitrate dehydrogenase, peroxisomalepididymis luminal protein 216epididymis secretory protein Li 26epididymis secretor | |
Modification date | 20200327 | 20200313 | |
UniProtAcc | Q15303 | O75874 | |
Ensembl transtripts involved in fusion gene | ENST00000342788, ENST00000402597, ENST00000436443, ENST00000484474, | ENST00000345146, ENST00000446179, ENST00000415913, | |
Fusion gene scores | * DoF score | 19 X 15 X 4=1140 | 6 X 5 X 3=90 |
# samples | 21 | 6 | |
** MAII score | log2(21/1140*10)=-2.44057259138598 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/90*10)=-0.584962500721156 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: ERBB4 [Title/Abstract] AND IDH1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | ERBB4(212989477)-IDH1(209101893), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | ERBB4-IDH1 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. ERBB4-IDH1 seems lost the major protein functional domain in Hgene partner, which is a epigenetic factor due to the frame-shifted ORF. ERBB4-IDH1 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. ERBB4-IDH1 seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. ERBB4-IDH1 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. ERBB4-IDH1 seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. ERBB4-IDH1 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. ERBB4-IDH1 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. ERBB4-IDH1 seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ERBB4 | GO:0007165 | signal transduction | 10572067 |
Hgene | ERBB4 | GO:0007169 | transmembrane receptor protein tyrosine kinase signaling pathway | 10353604|18334220 |
Hgene | ERBB4 | GO:0016477 | cell migration | 9135143 |
Hgene | ERBB4 | GO:0018108 | peptidyl-tyrosine phosphorylation | 18334220 |
Hgene | ERBB4 | GO:0046777 | protein autophosphorylation | 18334220 |
Tgene | IDH1 | GO:0006102 | isocitrate metabolic process | 10521434|19935646|20171178 |
Tgene | IDH1 | GO:0006103 | 2-oxoglutarate metabolic process | 19935646 |
Fusion gene breakpoints across ERBB4 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across IDH1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | OV | TCGA-24-2289-01A | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
Top |
Fusion Gene ORF analysis for ERBB4-IDH1 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
Frame-shift | ENST00000342788 | ENST00000345146 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
Frame-shift | ENST00000342788 | ENST00000446179 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
Frame-shift | ENST00000402597 | ENST00000345146 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
Frame-shift | ENST00000402597 | ENST00000446179 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
Frame-shift | ENST00000436443 | ENST00000345146 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
Frame-shift | ENST00000436443 | ENST00000446179 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
In-frame | ENST00000342788 | ENST00000415913 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
In-frame | ENST00000402597 | ENST00000415913 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
In-frame | ENST00000436443 | ENST00000415913 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
intron-3CDS | ENST00000484474 | ENST00000345146 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
intron-3CDS | ENST00000484474 | ENST00000415913 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
intron-3CDS | ENST00000484474 | ENST00000446179 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000436443 | ERBB4 | chr2 | 212989477 | - | ENST00000415913 | IDH1 | chr2 | 209101893 | - | 1450 | 545 | 401 | 102 | 99 |
ENST00000342788 | ERBB4 | chr2 | 212989477 | - | ENST00000415913 | IDH1 | chr2 | 209101893 | - | 1450 | 545 | 401 | 102 | 99 |
ENST00000402597 | ERBB4 | chr2 | 212989477 | - | ENST00000415913 | IDH1 | chr2 | 209101893 | - | 1139 | 234 | 883 | 632 | 83 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000436443 | ENST00000415913 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - | 0.33929557 | 0.66070443 |
ENST00000342788 | ENST00000415913 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - | 0.33929557 | 0.66070443 |
ENST00000402597 | ENST00000415913 | ERBB4 | chr2 | 212989477 | - | IDH1 | chr2 | 209101893 | - | 0.2059271 | 0.79407287 |
Top |
Fusion Genomic Features for ERBB4-IDH1 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for ERBB4-IDH1 |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:212989477/chr2:209101893) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
ERBB4 | IDH1 |
FUNCTION: Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins and EGF family members and regulates development of the heart, the central nervous system and the mammary gland, gene transcription, cell proliferation, differentiation, migration and apoptosis. Required for normal cardiac muscle differentiation during embryonic development, and for postnatal cardiomyocyte proliferation. Required for normal development of the embryonic central nervous system, especially for normal neural crest cell migration and normal axon guidance. Required for mammary gland differentiation, induction of milk proteins and lactation. Acts as cell-surface receptor for the neuregulins NRG1, NRG2, NRG3 and NRG4 and the EGF family members BTC, EREG and HBEGF. Ligand binding triggers receptor dimerization and autophosphorylation at specific tyrosine residues that then serve as binding sites for scaffold proteins and effectors. Ligand specificity and signaling is modulated by alternative splicing, proteolytic processing, and by the formation of heterodimers with other ERBB family members, thereby creating multiple combinations of intracellular phosphotyrosines that trigger ligand- and context-specific cellular responses. Mediates phosphorylation of SHC1 and activation of the MAP kinases MAPK1/ERK2 and MAPK3/ERK1. Isoform JM-A CYT-1 and isoform JM-B CYT-1 phosphorylate PIK3R1, leading to the activation of phosphatidylinositol 3-kinase and AKT1 and protect cells against apoptosis. Isoform JM-A CYT-1 and isoform JM-B CYT-1 mediate reorganization of the actin cytoskeleton and promote cell migration in response to NRG1. Isoform JM-A CYT-2 and isoform JM-B CYT-2 lack the phosphotyrosine that mediates interaction with PIK3R1, and hence do not phosphorylate PIK3R1, do not protect cells against apoptosis, and do not promote reorganization of the actin cytoskeleton and cell migration. Proteolytic processing of isoform JM-A CYT-1 and isoform JM-A CYT-2 gives rise to the corresponding soluble intracellular domains (4ICD) that translocate to the nucleus, promote nuclear import of STAT5A, activation of STAT5A, mammary epithelium differentiation, cell proliferation and activation of gene expression. The ERBB4 soluble intracellular domains (4ICD) colocalize with STAT5A at the CSN2 promoter to regulate transcription of milk proteins during lactation. The ERBB4 soluble intracellular domains can also translocate to mitochondria and promote apoptosis. {ECO:0000269|PubMed:10348342, ECO:0000269|PubMed:10353604, ECO:0000269|PubMed:10358079, ECO:0000269|PubMed:10722704, ECO:0000269|PubMed:10867024, ECO:0000269|PubMed:11178955, ECO:0000269|PubMed:11390655, ECO:0000269|PubMed:12807903, ECO:0000269|PubMed:15534001, ECO:0000269|PubMed:15746097, ECO:0000269|PubMed:16251361, ECO:0000269|PubMed:16778220, ECO:0000269|PubMed:16837552, ECO:0000269|PubMed:17486069, ECO:0000269|PubMed:17638867, ECO:0000269|PubMed:19098003, ECO:0000269|PubMed:20858735, ECO:0000269|PubMed:8383326, ECO:0000269|PubMed:8617750, ECO:0000269|PubMed:9135143, ECO:0000269|PubMed:9168115, ECO:0000269|PubMed:9334263}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 186_334 | 78 | 1309.0 | Compositional bias | Note=Cys-rich |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 496_633 | 78 | 1309.0 | Compositional bias | Note=Cys-rich |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 186_334 | 78 | 1299.0 | Compositional bias | Note=Cys-rich |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 496_633 | 78 | 1299.0 | Compositional bias | Note=Cys-rich |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 186_334 | 78 | 1293.0 | Compositional bias | Note=Cys-rich |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 496_633 | 78 | 1293.0 | Compositional bias | Note=Cys-rich |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 718_985 | 78 | 1309.0 | Domain | Protein kinase |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 718_985 | 78 | 1299.0 | Domain | Protein kinase |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 718_985 | 78 | 1293.0 | Domain | Protein kinase |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 1032_1035 | 78 | 1309.0 | Motif | Note=PPxY motif 1 |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 1053_1056 | 78 | 1309.0 | Motif | Note=PPxY motif 2 |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 1298_1301 | 78 | 1309.0 | Motif | Note=PPxY motif 3 |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 1306_1308 | 78 | 1309.0 | Motif | Note=PDZ-binding |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 676_684 | 78 | 1309.0 | Motif | Note=Nuclear localization signal |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 1032_1035 | 78 | 1299.0 | Motif | Note=PPxY motif 1 |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 1053_1056 | 78 | 1299.0 | Motif | Note=PPxY motif 2 |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 1298_1301 | 78 | 1299.0 | Motif | Note=PPxY motif 3 |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 1306_1308 | 78 | 1299.0 | Motif | Note=PDZ-binding |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 676_684 | 78 | 1299.0 | Motif | Note=Nuclear localization signal |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 1032_1035 | 78 | 1293.0 | Motif | Note=PPxY motif 1 |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 1053_1056 | 78 | 1293.0 | Motif | Note=PPxY motif 2 |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 1298_1301 | 78 | 1293.0 | Motif | Note=PPxY motif 3 |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 1306_1308 | 78 | 1293.0 | Motif | Note=PDZ-binding |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 676_684 | 78 | 1293.0 | Motif | Note=Nuclear localization signal |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 724_732 | 78 | 1309.0 | Nucleotide binding | ATP |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 797_799 | 78 | 1309.0 | Nucleotide binding | ATP |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 843_848 | 78 | 1309.0 | Nucleotide binding | ATP |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 724_732 | 78 | 1299.0 | Nucleotide binding | ATP |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 797_799 | 78 | 1299.0 | Nucleotide binding | ATP |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 843_848 | 78 | 1299.0 | Nucleotide binding | ATP |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 724_732 | 78 | 1293.0 | Nucleotide binding | ATP |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 797_799 | 78 | 1293.0 | Nucleotide binding | ATP |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 843_848 | 78 | 1293.0 | Nucleotide binding | ATP |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 26_651 | 78 | 1309.0 | Topological domain | Extracellular |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 676_1308 | 78 | 1309.0 | Topological domain | Cytoplasmic |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 26_651 | 78 | 1299.0 | Topological domain | Extracellular |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 676_1308 | 78 | 1299.0 | Topological domain | Cytoplasmic |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 26_651 | 78 | 1293.0 | Topological domain | Extracellular |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 676_1308 | 78 | 1293.0 | Topological domain | Cytoplasmic |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000342788 | - | 2 | 28 | 652_675 | 78 | 1309.0 | Transmembrane | Helical |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000402597 | - | 2 | 28 | 652_675 | 78 | 1299.0 | Transmembrane | Helical |
Hgene | ERBB4 | chr2:212989477 | chr2:209101893 | ENST00000436443 | - | 2 | 27 | 652_675 | 78 | 1293.0 | Transmembrane | Helical |
Tgene | IDH1 | chr2:212989477 | chr2:209101893 | ENST00000345146 | 8 | 10 | 310_315 | 384 | 415.0 | Nucleotide binding | NADP | |
Tgene | IDH1 | chr2:212989477 | chr2:209101893 | ENST00000345146 | 8 | 10 | 75_77 | 384 | 415.0 | Nucleotide binding | NADP | |
Tgene | IDH1 | chr2:212989477 | chr2:209101893 | ENST00000415913 | 8 | 10 | 310_315 | 384 | 415.0 | Nucleotide binding | NADP | |
Tgene | IDH1 | chr2:212989477 | chr2:209101893 | ENST00000415913 | 8 | 10 | 75_77 | 384 | 415.0 | Nucleotide binding | NADP | |
Tgene | IDH1 | chr2:212989477 | chr2:209101893 | ENST00000446179 | 8 | 10 | 310_315 | 384 | 415.0 | Nucleotide binding | NADP | |
Tgene | IDH1 | chr2:212989477 | chr2:209101893 | ENST00000446179 | 8 | 10 | 75_77 | 384 | 415.0 | Nucleotide binding | NADP | |
Tgene | IDH1 | chr2:212989477 | chr2:209101893 | ENST00000345146 | 8 | 10 | 94_100 | 384 | 415.0 | Region | Substrate binding | |
Tgene | IDH1 | chr2:212989477 | chr2:209101893 | ENST00000415913 | 8 | 10 | 94_100 | 384 | 415.0 | Region | Substrate binding | |
Tgene | IDH1 | chr2:212989477 | chr2:209101893 | ENST00000446179 | 8 | 10 | 94_100 | 384 | 415.0 | Region | Substrate binding |
Top |
Fusion Gene Sequence for ERBB4-IDH1 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>27227_27227_1_ERBB4-IDH1_ERBB4_chr2_212989477_ENST00000342788_IDH1_chr2_209101893_ENST00000415913_length(transcript)=1450nt_BP=545nt GGAGCGAGCAAGCGAAGGCTCACGCGGGGAAATAGCTGCACAGTCCGGCCCAGAGCGCCAAGCGCACACACCGAGCACACTCCCACACGC GCACACACGCGCTCACACTCGCCCCCTCCTCGGGCCCCGGCCCTGGACCCGCGGGCGCGGACTCGGTCGCCCGCCCTGGGAGTCGCCACA CCGCGCGCGCCGCGCCCGCCCCCCTCGCACCCCCACGCGCGCCCGGCTGGGGGATCTCCTCCGCGTGCCCGAAAGGGGGATATGCCATTT GGACATGTAATTGTCAGCACGGGATCTGAGACTTCCAAAAAATGAAGCCGGCGACAGGACTTTGGGTCTGGGTGAGCCTTCTCGTGGCGG CGGGGACCGTCCAGCCCAGCGATTCTCAGTCAGTGTGTGCAGGAACGGAGAATAAACTGAGCTCTCTCTCTGACCTGGAACAGCAGTACC GAGCCTTGCGCAAGTACTATGAAAACTGTGAGGTTGTCATGGGCAACCTGGAGATAACCAGCATTGAGCACAACCGGGACCTCTCCTTCC TGCGGTGTGCAACGTTCTGACTACTTGAATACATTTGAGTTCATGGATAAACTTGGAGAAAACTTGAAGATCAAACTAGCTCAGGCCAAA CTTTAAGTTCATACCTGAGCTAAGAAGGATAATTGTCTTTTGGTAACTAGGTCTACAGGTTTACATTTTTCTGTGTTACACTCAAGGATA AAGGCAAAATCAATTTTGTAATTTGTTTAGAAGCCAGAGTTTATCTTTTCTATAAGTTTACAGCCTTTTTCTTATATATACAGTTATTGC CACCTTTGTGAACATGGCAAGGGACTTTTTTACAATTTTTATTTTATTTTCTAGTACCAGCCTAGGAATTCGGTTAGTACTCATTTGTAT TCACTGTCACTTTTTCTCATGTTCTAATTATAAATGACCAAAATCAAGATTGCTCAAAAGGGTAAATGATAGCCACAGTATTGCTCCCTA AAATATGCATAAAGTAGAAATTCACTGCCTTCCCCTCCTGTCCATGACCTTGGGCACAGGGAAGTTCTGGTGTCATAGATATCCCGTTTT GTGAGGTAGAGCTGTGCATTAAACTTGCACATGACTGGAACGAAGTAGGAGTGCAACTCAAATGTGTTGAAGATACTGCAGTCATTTTTG TAAAGACCTTGCTGAATGTTTCCAATAGACTAAATACTGTTTAGGCCGCAGGAGAGTTTGGAATCCGGAATAAATACTACCTGGAGGTTT GTCCTCTCCATTTTTCTCTTTCTCCTCCTGGCCTGGCCTGAATATTATACTACTCTAAATAGCATATTTCATCCAAGTGCAATAATGTAA GCTGAATCTTTTTTGGACTTCTGCTGGCCTGTTTTATTTCTTTTATATAAATGTGATTTCTCAGAAATTGATATTAAACACTATCTTATC >27227_27227_1_ERBB4-IDH1_ERBB4_chr2_212989477_ENST00000342788_IDH1_chr2_209101893_ENST00000415913_length(amino acids)=99AA_BP= MHTLTENRWAGRSPPPREGSPRPKVLSPASFFGSLRSRADNYMSKWHIPLSGTRRRSPSRARVGVRGGRARRARCGDSQGGRPSPRPRVQ -------------------------------------------------------------- >27227_27227_2_ERBB4-IDH1_ERBB4_chr2_212989477_ENST00000402597_IDH1_chr2_209101893_ENST00000415913_length(transcript)=1139nt_BP=234nt ATGAAGCCGGCGACAGGACTTTGGGTCTGGGTGAGCCTTCTCGTGGCGGCGGGGACCGTCCAGCCCAGCGATTCTCAGTCAGTGTGTGCA GGAACGGAGAATAAACTGAGCTCTCTCTCTGACCTGGAACAGCAGTACCGAGCCTTGCGCAAGTACTATGAAAACTGTGAGGTTGTCATG GGCAACCTGGAGATAACCAGCATTGAGCACAACCGGGACCTCTCCTTCCTGCGGTGTGCAACGTTCTGACTACTTGAATACATTTGAGTT CATGGATAAACTTGGAGAAAACTTGAAGATCAAACTAGCTCAGGCCAAACTTTAAGTTCATACCTGAGCTAAGAAGGATAATTGTCTTTT GGTAACTAGGTCTACAGGTTTACATTTTTCTGTGTTACACTCAAGGATAAAGGCAAAATCAATTTTGTAATTTGTTTAGAAGCCAGAGTT TATCTTTTCTATAAGTTTACAGCCTTTTTCTTATATATACAGTTATTGCCACCTTTGTGAACATGGCAAGGGACTTTTTTACAATTTTTA TTTTATTTTCTAGTACCAGCCTAGGAATTCGGTTAGTACTCATTTGTATTCACTGTCACTTTTTCTCATGTTCTAATTATAAATGACCAA AATCAAGATTGCTCAAAAGGGTAAATGATAGCCACAGTATTGCTCCCTAAAATATGCATAAAGTAGAAATTCACTGCCTTCCCCTCCTGT CCATGACCTTGGGCACAGGGAAGTTCTGGTGTCATAGATATCCCGTTTTGTGAGGTAGAGCTGTGCATTAAACTTGCACATGACTGGAAC GAAGTAGGAGTGCAACTCAAATGTGTTGAAGATACTGCAGTCATTTTTGTAAAGACCTTGCTGAATGTTTCCAATAGACTAAATACTGTT TAGGCCGCAGGAGAGTTTGGAATCCGGAATAAATACTACCTGGAGGTTTGTCCTCTCCATTTTTCTCTTTCTCCTCCTGGCCTGGCCTGA ATATTATACTACTCTAAATAGCATATTTCATCCAAGTGCAATAATGTAAGCTGAATCTTTTTTGGACTTCTGCTGGCCTGTTTTATTTCT >27227_27227_2_ERBB4-IDH1_ERBB4_chr2_212989477_ENST00000402597_IDH1_chr2_209101893_ENST00000415913_length(amino acids)=83AA_BP= -------------------------------------------------------------- >27227_27227_3_ERBB4-IDH1_ERBB4_chr2_212989477_ENST00000436443_IDH1_chr2_209101893_ENST00000415913_length(transcript)=1450nt_BP=545nt GGAGCGAGCAAGCGAAGGCTCACGCGGGGAAATAGCTGCACAGTCCGGCCCAGAGCGCCAAGCGCACACACCGAGCACACTCCCACACGC GCACACACGCGCTCACACTCGCCCCCTCCTCGGGCCCCGGCCCTGGACCCGCGGGCGCGGACTCGGTCGCCCGCCCTGGGAGTCGCCACA CCGCGCGCGCCGCGCCCGCCCCCCTCGCACCCCCACGCGCGCCCGGCTGGGGGATCTCCTCCGCGTGCCCGAAAGGGGGATATGCCATTT GGACATGTAATTGTCAGCACGGGATCTGAGACTTCCAAAAAATGAAGCCGGCGACAGGACTTTGGGTCTGGGTGAGCCTTCTCGTGGCGG CGGGGACCGTCCAGCCCAGCGATTCTCAGTCAGTGTGTGCAGGAACGGAGAATAAACTGAGCTCTCTCTCTGACCTGGAACAGCAGTACC GAGCCTTGCGCAAGTACTATGAAAACTGTGAGGTTGTCATGGGCAACCTGGAGATAACCAGCATTGAGCACAACCGGGACCTCTCCTTCC TGCGGTGTGCAACGTTCTGACTACTTGAATACATTTGAGTTCATGGATAAACTTGGAGAAAACTTGAAGATCAAACTAGCTCAGGCCAAA CTTTAAGTTCATACCTGAGCTAAGAAGGATAATTGTCTTTTGGTAACTAGGTCTACAGGTTTACATTTTTCTGTGTTACACTCAAGGATA AAGGCAAAATCAATTTTGTAATTTGTTTAGAAGCCAGAGTTTATCTTTTCTATAAGTTTACAGCCTTTTTCTTATATATACAGTTATTGC CACCTTTGTGAACATGGCAAGGGACTTTTTTACAATTTTTATTTTATTTTCTAGTACCAGCCTAGGAATTCGGTTAGTACTCATTTGTAT TCACTGTCACTTTTTCTCATGTTCTAATTATAAATGACCAAAATCAAGATTGCTCAAAAGGGTAAATGATAGCCACAGTATTGCTCCCTA AAATATGCATAAAGTAGAAATTCACTGCCTTCCCCTCCTGTCCATGACCTTGGGCACAGGGAAGTTCTGGTGTCATAGATATCCCGTTTT GTGAGGTAGAGCTGTGCATTAAACTTGCACATGACTGGAACGAAGTAGGAGTGCAACTCAAATGTGTTGAAGATACTGCAGTCATTTTTG TAAAGACCTTGCTGAATGTTTCCAATAGACTAAATACTGTTTAGGCCGCAGGAGAGTTTGGAATCCGGAATAAATACTACCTGGAGGTTT GTCCTCTCCATTTTTCTCTTTCTCCTCCTGGCCTGGCCTGAATATTATACTACTCTAAATAGCATATTTCATCCAAGTGCAATAATGTAA GCTGAATCTTTTTTGGACTTCTGCTGGCCTGTTTTATTTCTTTTATATAAATGTGATTTCTCAGAAATTGATATTAAACACTATCTTATC >27227_27227_3_ERBB4-IDH1_ERBB4_chr2_212989477_ENST00000436443_IDH1_chr2_209101893_ENST00000415913_length(amino acids)=99AA_BP= MHTLTENRWAGRSPPPREGSPRPKVLSPASFFGSLRSRADNYMSKWHIPLSGTRRRSPSRARVGVRGGRARRARCGDSQGGRPSPRPRVQ -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ERBB4-IDH1 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ERBB4-IDH1 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for ERBB4-IDH1 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |