|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:FABP7-EPRS (FusionGDB2 ID:28210) |
Fusion Gene Summary for FABP7-EPRS |
Fusion gene summary |
Fusion gene information | Fusion gene name: FABP7-EPRS | Fusion gene ID: 28210 | Hgene | Tgene | Gene symbol | FABP7 | EPRS | Gene ID | 2173 | 2058 |
Gene name | fatty acid binding protein 7 | glutamyl-prolyl-tRNA synthetase 1 | |
Synonyms | B-FABP|BLBP|FABPB|MRG | EARS|EPRS|GLUPRORS|HLD15|PARS|PIG32|QARS|QPRS | |
Cytomap | 6q22.31 | 1q41 | |
Type of gene | protein-coding | protein-coding | |
Description | fatty acid-binding protein, brainbrain lipid-binding proteinbrain-type fatty acid-binding proteinhypothetical protein DKFZp547J2313mammary-derived growth inhibitor-related | bifunctional glutamate/proline--tRNA ligasebifunctional aminoacyl-tRNA synthetasecell proliferation-inducing gene 32 proteinglutamate tRNA ligaseglutamatyl-prolyl-tRNA synthetaseglutaminyl-tRNA synthetaseproliferation-inducing gene 32 proteinprolif | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | O15540 | P07814 | |
Ensembl transtripts involved in fusion gene | ENST00000356535, ENST00000368444, | ENST00000468487, ENST00000366923, | |
Fusion gene scores | * DoF score | 2 X 2 X 2=8 | 9 X 9 X 4=324 |
# samples | 2 | 9 | |
** MAII score | log2(2/8*10)=1.32192809488736 | log2(9/324*10)=-1.84799690655495 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: FABP7 [Title/Abstract] AND EPRS [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | FABP7(123102339)-EPRS(220146740), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | FABP7-EPRS seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. FABP7-EPRS seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. FABP7-EPRS seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | EPRS | GO:0006433 | prolyl-tRNA aminoacylation | 24100331 |
Tgene | EPRS | GO:0017148 | negative regulation of translation | 23071094 |
Tgene | EPRS | GO:0071346 | cellular response to interferon-gamma | 15479637 |
Fusion gene breakpoints across FABP7 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across EPRS (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | GBM | TCGA-06-2563 | FABP7 | chr6 | 123102339 | + | EPRS | chr1 | 220146740 | - |
Top |
Fusion Gene ORF analysis for FABP7-EPRS |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000356535 | ENST00000468487 | FABP7 | chr6 | 123102339 | + | EPRS | chr1 | 220146740 | - |
5CDS-intron | ENST00000368444 | ENST00000468487 | FABP7 | chr6 | 123102339 | + | EPRS | chr1 | 220146740 | - |
Frame-shift | ENST00000356535 | ENST00000366923 | FABP7 | chr6 | 123102339 | + | EPRS | chr1 | 220146740 | - |
In-frame | ENST00000368444 | ENST00000366923 | FABP7 | chr6 | 123102339 | + | EPRS | chr1 | 220146740 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000368444 | FABP7 | chr6 | 123102339 | + | ENST00000366923 | EPRS | chr1 | 220146740 | - | 1329 | 668 | 320 | 1123 | 267 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000368444 | ENST00000366923 | FABP7 | chr6 | 123102339 | + | EPRS | chr1 | 220146740 | - | 0.002091202 | 0.99790883 |
Top |
Fusion Genomic Features for FABP7-EPRS |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for FABP7-EPRS |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr6:123102339/chr1:220146740) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
FABP7 | EPRS |
FUNCTION: B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers (By similarity). {ECO:0000250}. | FUNCTION: Multifunctional protein which is primarily part of the aminoacyl-tRNA synthetase multienzyme complex, also know as multisynthetase complex, that catalyzes the attachment of the cognate amino acid to the corresponding tRNA in a two-step reaction: the amino acid is first activated by ATP to form a covalent intermediate with AMP and is then transferred to the acceptor end of the cognate tRNA (PubMed:1756734, PubMed:24100331, PubMed:23263184). The phosphorylation of EPRS1, induced by interferon-gamma, dissociates the protein from the aminoacyl-tRNA synthetase multienzyme complex and recruits it to the GAIT complex that binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin), suppressing their translation. Interferon-gamma can therefore redirect, in specific cells, the EPRS1 function from protein synthesis to translation inhibition (PubMed:15479637, PubMed:23071094). Also functions as an effector of the mTORC1 signaling pathway by promoting, through SLC27A1, the uptake of long-chain fatty acid by adipocytes. Thereby, it also plays a role in fat metabolism and more indirectly influences lifespan (PubMed:28178239). {ECO:0000269|PubMed:15479637, ECO:0000269|PubMed:1756734, ECO:0000269|PubMed:23071094, ECO:0000269|PubMed:23263184, ECO:0000269|PubMed:24100331, ECO:0000269|PubMed:28178239}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | FABP7 | chr6:123102339 | chr1:220146740 | ENST00000368444 | + | 3 | 4 | 127_129 | 116 | 133.0 | Region | Note=Fatty acid binding |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 961_991 | 1361 | 1513.0 | Compositional bias | Lys-rich | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 749_805 | 1361 | 1513.0 | Domain | Note=WHEP-TRS 1 | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 822_878 | 1361 | 1513.0 | Domain | Note=WHEP-TRS 2 | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 900_956 | 1361 | 1513.0 | Domain | Note=WHEP-TRS 3 | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 204_214 | 1361 | 1513.0 | Motif | Note='HIGH' region | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 432_436 | 1361 | 1513.0 | Motif | Note='KMSKS' region | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 1152_1154 | 1361 | 1513.0 | Nucleotide binding | ATP | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 1163_1164 | 1361 | 1513.0 | Nucleotide binding | ATP | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 1237_1240 | 1361 | 1513.0 | Nucleotide binding | ATP | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 1007_1512 | 1361 | 1513.0 | Region | Note=Proline--tRNA ligase | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 1121_1123 | 1361 | 1513.0 | Region | L-proline binding | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 164_759 | 1361 | 1513.0 | Region | Note=Glutamate--tRNA ligase | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 760_956 | 1361 | 1513.0 | Region | Note=3 X 57 AA approximate repeats | |
Tgene | EPRS | chr6:123102339 | chr1:220146740 | ENST00000366923 | 27 | 32 | 959_991 | 1361 | 1513.0 | Region | Note=Charged |
Top |
Fusion Gene Sequence for FABP7-EPRS |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>28210_28210_1_FABP7-EPRS_FABP7_chr6_123102339_ENST00000368444_EPRS_chr1_220146740_ENST00000366923_length(transcript)=1329nt_BP=668nt TTTCTCAGGCATAAGGGCTGTAGTGTGAGGATTGGGAGGAACTCGACCTACTCCGCTAACCCAGTGGCCTGAGCCAATCACAAAGAGGAT TGGAGCCTCACTCGAGCGCTCCTTCCCTTCTCCTCTCTCTGTGACAGCCTCTTGGAAAGAGGGACACTGGAGGGGTGTGTTTGCAATTTA AATCACTGGATTTTTGCCCACCCTCTTTCCAAATAAGAAGGCAGGAGCTGCTTGCTGAGGTGTAAAGGGTCTTCTGAGCTGCAGTGGCAA TTAGACCAGAAGATCCCCGCTCCTGTCTCTAAAGAGGGGAAAGGGCAAGGATGGTGGAGGCTTTCTGTGCTACCTGGAAGCTGACCAACA GTCAGAACTTTGATGAGTACATGAAGGCTCTAGGCGTGGGCTTTGCCACTAGGCAGGTGGGAAATGTGACCAAACCAACGGTAATTATCA GTCAAGAAGGAGACAAAGTGGTCATCAGGACTCTCAGCACATTCAAGAACACGGAGATTAGTTTCCAGCTGGGAGAAGAGTTTGATGAAA CCACTGCAGATGATAGAAACTGTAAGTCTGTTGTTAGCCTGGATGGAGACAAACTTGTTCACATACAGAAATGGGATGGCAAAGAAACAA ATTTTGTAAGAGAAATTAAGGATGGCAAAATGGTTATGGGAGTTCCCATTAGACTTGAAGTTGGGCCACGTGATATGAAGAGCTGTCAGT TTGTAGCCGTCAGACGAGATACTGGAGAAAAGCTGACAGTTGCTGAAAATGAGGCAGAGACTAAACTTCAAGCTATTTTGGAAGACATCC AGGTCACCCTTTTCACAAGGGCTTCTGAAGACCTTAAGACTCATATGGTTGTGGCTAATACAATGGAAGACTTTCAGAAGATACTAGATT CTGGAAAGATTGTTCAGATTCCATTCTGTGGGGAAATTGACTGTGAGGACTGGATCAAAAAGACCACTGCCAGGGATCAAGATCTTGAAC CTGGTGCTCCATCCATGGGAGCTAAAAGCCTTTGCATCCCCTTCAAACCACTCTGTGAACTGCAGCCTGGAGCCAAATGTGTCTGTGGCA AGAACCCTGCCAAGTACTACACCTTATTTGGTCGCAGCTACTGAGGGATGAACGAAAGCCCCCTCTTCAACTCCTCTCACTTTTTAAAGC ATTGATATTAGTATCTTCTCAGATACAGACCGTTTTATGATTTTTTAAAAAGTAAAAGTTCTAAAATGAAGTCACACAGGACAATTATTC >28210_28210_1_FABP7-EPRS_FABP7_chr6_123102339_ENST00000368444_EPRS_chr1_220146740_ENST00000366923_length(amino acids)=267AA_BP=116 MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGD KLVHIQKWDGKETNFVREIKDGKMVMGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMV -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for FABP7-EPRS |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for FABP7-EPRS |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for FABP7-EPRS |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |