|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:AKAP8-CALR3 (FusionGDB2 ID:3366) |
Fusion Gene Summary for AKAP8-CALR3 |
Fusion gene summary |
Fusion gene information | Fusion gene name: AKAP8-CALR3 | Fusion gene ID: 3366 | Hgene | Tgene | Gene symbol | AKAP8 | CALR3 | Gene ID | 10270 | 125972 |
Gene name | A-kinase anchoring protein 8 | calreticulin 3 | |
Synonyms | AKAP 95|AKAP-8|AKAP-95|AKAP95 | CMH19|CRT2|CT93 | |
Cytomap | 19p13.12 | 19p13.11 | |
Type of gene | protein-coding | protein-coding | |
Description | A-kinase anchor protein 8A kinase (PRKA) anchor protein 8A-kinase anchor protein, 95kDa | calreticulin-3calreticulin-2calsperincancer/testis antigen 93testis secretory sperm-binding protein Li 226n | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | O43823 | Q96L12 | |
Ensembl transtripts involved in fusion gene | ENST00000269701, | ENST00000602234, ENST00000269881, | |
Fusion gene scores | * DoF score | 13 X 14 X 9=1638 | 3 X 6 X 5=90 |
# samples | 17 | 9 | |
** MAII score | log2(17/1638*10)=-3.26832870550331 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/90*10)=0 | |
Context | PubMed: AKAP8 [Title/Abstract] AND CALR3 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | AKAP8(15487787)-CALR3(16601381), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Fusion gene breakpoints across AKAP8 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across CALR3 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | SARC | TCGA-3B-A9HP-01A | AKAP8 | chr19 | 15487787 | - | CALR3 | chr19 | 16601381 | - |
Top |
Fusion Gene ORF analysis for AKAP8-CALR3 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000269701 | ENST00000602234 | AKAP8 | chr19 | 15487787 | - | CALR3 | chr19 | 16601381 | - |
In-frame | ENST00000269701 | ENST00000269881 | AKAP8 | chr19 | 15487787 | - | CALR3 | chr19 | 16601381 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000269701 | AKAP8 | chr19 | 15487787 | - | ENST00000269881 | CALR3 | chr19 | 16601381 | - | 1155 | 119 | 37 | 1080 | 347 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000269701 | ENST00000269881 | AKAP8 | chr19 | 15487787 | - | CALR3 | chr19 | 16601381 | - | 0.002306821 | 0.9976931 |
Top |
Fusion Genomic Features for AKAP8-CALR3 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for AKAP8-CALR3 |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:15487787/chr19:16601381) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
AKAP8 | CALR3 |
FUNCTION: Anchoring protein that mediates the subcellular compartmentation of cAMP-dependent protein kinase (PKA type II) (PubMed:9473338). Acts as an anchor for a PKA-signaling complex onto mitotic chromosomes, which is required for maintenance of chromosomes in a condensed form throughout mitosis. Recruits condensin complex subunit NCAPD2 to chromosomes required for chromatin condensation; the function appears to be independent from PKA-anchoring (PubMed:10601332, PubMed:10791967, PubMed:11964380). May help to deliver cyclin D/E to CDK4 to facilitate cell cycle progression (PubMed:14641107). Required for cell cycle G2/M transition and histone deacetylation during mitosis. In mitotic cells recruits HDAC3 to the vicinity of chromatin leading to deacetylation and subsequent phosphorylation at 'Ser-10' of histone H3; in this function may act redundantly with AKAP8L (PubMed:16980585). Involved in nuclear retention of RPS6KA1 upon ERK activation thus inducing cell proliferation (PubMed:22130794). May be involved in regulation of DNA replication by acting as scaffold for MCM2 (PubMed:12740381). Enhances HMT activity of the KMT2 family MLL4/WBP7 complex and is involved in transcriptional regulation. In a teratocarcinoma cell line is involved in retinoic acid-mediated induction of developmental genes implicating H3 'Lys-4' methylation (PubMed:23995757). May be involved in recruitment of active CASP3 to the nucleus in apoptotic cells (PubMed:16227597). May act as a carrier protein of GJA1 for its transport to the nucleus (PubMed:26880274). May play a repressive role in the regulation of rDNA transcription. Preferentially binds GC-rich DNA in vitro. In cells, associates with ribosomal RNA (rRNA) chromatin, preferentially with rRNA promoter and transcribed regions (PubMed:26683827). Involved in modulation of Toll-like receptor signaling. Required for the cAMP-dependent suppression of TNF-alpha in early stages of LPS-induced macrophage activation; the function probably implicates targeting of PKA to NFKB1 (By similarity). {ECO:0000250|UniProtKB:Q63014, ECO:0000250|UniProtKB:Q9DBR0, ECO:0000269|PubMed:10601332, ECO:0000269|PubMed:10791967, ECO:0000269|PubMed:11964380, ECO:0000269|PubMed:16980585, ECO:0000269|PubMed:22130794, ECO:0000269|PubMed:26683827, ECO:0000269|PubMed:26880274, ECO:0000305|PubMed:14641107, ECO:0000305|PubMed:9473338}. | FUNCTION: During spermatogenesis, may act as a lectin-independent chaperone for specific client proteins such as ADAM3. Required for sperm fertility (By similarity). CALR3 capacity for calcium-binding may be absent or much lower than that of CALR. {ECO:0000250, ECO:0000269|PubMed:21590275}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 337_362 | 64 | 385.0 | Compositional bias | Note=Glu/Lys-rich | |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 381_384 | 64 | 385.0 | Motif | Prevents secretion from ER | |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 191_245 | 64 | 385.0 | Region | Note=4 X approximate repeats | |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 198_294 | 64 | 385.0 | Region | Note=P-domain | |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 249_283 | 64 | 385.0 | Region | Note=3 X approximate repeats | |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 295_384 | 64 | 385.0 | Region | Note=C-domain | |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 191_202 | 64 | 385.0 | Repeat | Note=1-1 | |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 208_219 | 64 | 385.0 | Repeat | Note=1-2 | |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 221_230 | 64 | 385.0 | Repeat | Note=1-3 | |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 234_245 | 64 | 385.0 | Repeat | Note=1-4 | |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 249_259 | 64 | 385.0 | Repeat | Note=2-1 | |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 263_271 | 64 | 385.0 | Repeat | Note=2-2 | |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 273_283 | 64 | 385.0 | Repeat | Note=2-3 |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | AKAP8 | chr19:15487787 | chr19:16601381 | ENST00000269701 | - | 2 | 14 | 107_118 | 19 | 693.0 | Compositional bias | Note=Poly-Gly |
Hgene | AKAP8 | chr19:15487787 | chr19:16601381 | ENST00000269701 | - | 2 | 14 | 289_306 | 19 | 693.0 | Motif | Bipartite nuclear localization signal |
Hgene | AKAP8 | chr19:15487787 | chr19:16601381 | ENST00000269701 | - | 2 | 14 | 387_450 | 19 | 693.0 | Region | Involved in chromatin-binding |
Hgene | AKAP8 | chr19:15487787 | chr19:16601381 | ENST00000269701 | - | 2 | 14 | 525_569 | 19 | 693.0 | Region | Involved in condensin complex recruitment |
Hgene | AKAP8 | chr19:15487787 | chr19:16601381 | ENST00000269701 | - | 2 | 14 | 572_589 | 19 | 693.0 | Region | RII-binding |
Hgene | AKAP8 | chr19:15487787 | chr19:16601381 | ENST00000269701 | - | 2 | 14 | 392_414 | 19 | 693.0 | Zinc finger | C2H2 AKAP95-type 1 |
Hgene | AKAP8 | chr19:15487787 | chr19:16601381 | ENST00000269701 | - | 2 | 14 | 481_504 | 19 | 693.0 | Zinc finger | C2H2 AKAP95-type 2 |
Tgene | CALR3 | chr19:15487787 | chr19:16601381 | ENST00000269881 | 1 | 9 | 20_197 | 64 | 385.0 | Region | Note=N-domain |
Top |
Fusion Gene Sequence for AKAP8-CALR3 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>3366_3366_1_AKAP8-CALR3_AKAP8_chr19_15487787_ENST00000269701_CALR3_chr19_16601381_ENST00000269881_length(transcript)=1155nt_BP=119nt TGAACGCATGCGTGCTGTGGTCGCCTAGTAAACGGGGCTGCTGGTGGGCCGCGTCGAAGACATGGACCAGGGCTACGGAGGCTACGGGGC GTGGAGTGCTGGACCTGCCAACACCCAGGGTCTGCAAACCACTCAGAATGGCCGATTCTATGCCATCTCTGCACGCTTCAAACCGTTCAG CAATAAAGGGAAAACTCTGGTTATTCAGTACACAGTAAAACATGAGCAGAAGATGGACTGTGGAGGGGGCTACATTAAGGTCTTTCCTGC AGACATTGACCAGAAGAACCTGAATGGAAAATCGCAGTACTATATTATGTTTGGACCCGATATTTGTGGATTTGATATCAAGAAAGTTCA TGTTATTTTACATTTCAAGAATAAGTATCACGAAAACAAGAAACTGATCAGGTGTAAGGTTGATGGCTTCACACACCTGTACACTCTAAT TTTAAGACCAGATCTTTCTTATGATGTGAAAATTGATGGTCAGTCAATTGAATCCGGCAGCATAGAGTACGACTGGAACTTAACATCACT CAAGAAGGAAACGTCCCCGGCAGAATCGAAGGATTGGGAACAGACTAAAGACAACAAAGCCCAGGACTGGGAGAAGCATTTTCTGGACGC CAGCACCAGCAAGCAGAGCGACTGGAACGGTGACCTGGATGGGGACTGGCCAGCGCCGATGCTCCAGAAGCCCCCGTACCAGGATGGCCT GAAACCAGAAGGTATTCATAAAGACGTCTGGCTCCACCGTAAGATGAAGAATACCGACTATTTGACGCAGTATGACCTCTCAGAATTTGA GAACATTGGTGCCATTGGCCTGGAGCTTTGGCAGGTGAGATCTGGAACCATTTTTGATAACTTTCTGATCACAGATGATGAAGAGTACGC AGATAATTTTGGCAAGGCCACCTGGGGCGAAACCAAGGGTCCAGAAAGGGAGATGGATGCCATACAGGCCAAGGAGGAAATGAAGAAGGC CCGCGAGGAAGAGGAGGAAGAGCTGCTGTCGGGAAAAATTAACAGGCACGAACATTACTTCAATCAATTTCACAGAAGGAATGAACTTTA >3366_3366_1_AKAP8-CALR3_AKAP8_chr19_15487787_ENST00000269701_CALR3_chr19_16601381_ENST00000269881_length(amino acids)=347AA_BP=27 MLVGRVEDMDQGYGGYGAWSAGPANTQGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQ YYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDW EQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQV -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for AKAP8-CALR3 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Hgene | AKAP8 | chr19:15487787 | chr19:16601381 | ENST00000269701 | - | 2 | 14 | 109_201 | 19.333333333333332 | 693.0 | DDX5 |
Hgene | AKAP8 | chr19:15487787 | chr19:16601381 | ENST00000269701 | - | 2 | 14 | 1_210 | 19.333333333333332 | 693.0 | DPY30 |
Hgene | AKAP8 | chr19:15487787 | chr19:16601381 | ENST00000269701 | - | 2 | 14 | 1_195 | 19.333333333333332 | 693.0 | MCM2 |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for AKAP8-CALR3 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for AKAP8-CALR3 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |