|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:AKT1-B2M (FusionGDB2 ID:3464) |
Fusion Gene Summary for AKT1-B2M |
Fusion gene summary |
Fusion gene information | Fusion gene name: AKT1-B2M | Fusion gene ID: 3464 | Hgene | Tgene | Gene symbol | AKT1 | B2M | Gene ID | 207 | 567 |
Gene name | AKT serine/threonine kinase 1 | beta-2-microglobulin | |
Synonyms | AKT|CWS6|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA | IMD43 | |
Cytomap | 14q32.33 | 15q21.1 | |
Type of gene | protein-coding | protein-coding | |
Description | RAC-alpha serine/threonine-protein kinaseAKT1mPKB alphaRAC-PK-alphaprotein kinase B alphaproto-oncogene c-Aktrac protein kinase alphaserine-threonine protein kinasev-akt murine thymoma viral oncogene homolog 1v-akt murine thymoma viral oncogene-l | beta-2-microglobulinbeta chain of MHC class I moleculesbeta-2-microglobin | |
Modification date | 20200329 | 20200329 | |
UniProtAcc | P31749 | P61769 | |
Ensembl transtripts involved in fusion gene | ENST00000349310, ENST00000402615, ENST00000407796, ENST00000554581, ENST00000554848, ENST00000555528, ENST00000544168, ENST00000554192, ENST00000554585, ENST00000555458, | ENST00000559220, ENST00000544417, ENST00000558401, ENST00000559916, | |
Fusion gene scores | * DoF score | 10 X 6 X 4=240 | 64 X 31 X 17=33728 |
# samples | 10 | 71 | |
** MAII score | log2(10/240*10)=-1.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(71/33728*10)=-5.56998393724517 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: AKT1 [Title/Abstract] AND B2M [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | AKT1(105258935)-B2M(45007621), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | AKT1-B2M seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. AKT1-B2M seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. AKT1-B2M seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. AKT1-B2M seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. AKT1-B2M seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | AKT1 | GO:0001934 | positive regulation of protein phosphorylation | 19057511 |
Hgene | AKT1 | GO:0006468 | protein phosphorylation | 11994271|14749367|23431171 |
Hgene | AKT1 | GO:0007173 | epidermal growth factor receptor signaling pathway | 20878056 |
Hgene | AKT1 | GO:0016310 | phosphorylation | 20333297 |
Hgene | AKT1 | GO:0018105 | peptidyl-serine phosphorylation | 16139227 |
Hgene | AKT1 | GO:0018107 | peptidyl-threonine phosphorylation | 20605787 |
Hgene | AKT1 | GO:0030307 | positive regulation of cell growth | 19203586 |
Hgene | AKT1 | GO:0032079 | positive regulation of endodeoxyribonuclease activity | 20605787 |
Hgene | AKT1 | GO:0033138 | positive regulation of peptidyl-serine phosphorylation | 19667065 |
Hgene | AKT1 | GO:0035556 | intracellular signal transduction | 14749367 |
Hgene | AKT1 | GO:0035655 | interleukin-18-mediated signaling pathway | 21321938 |
Hgene | AKT1 | GO:0043066 | negative regulation of apoptotic process | 19203586 |
Hgene | AKT1 | GO:0043536 | positive regulation of blood vessel endothelial cell migration | 20011604 |
Hgene | AKT1 | GO:0048661 | positive regulation of smooth muscle cell proliferation | 21321938 |
Hgene | AKT1 | GO:0051091 | positive regulation of DNA-binding transcription factor activity | 19057511 |
Hgene | AKT1 | GO:0070141 | response to UV-A | 18483258 |
Tgene | B2M | GO:0002726 | positive regulation of T cell cytokine production | 24643698 |
Tgene | B2M | GO:0007611 | learning or memory | 26147761 |
Tgene | B2M | GO:0050680 | negative regulation of epithelial cell proliferation | 28213472 |
Tgene | B2M | GO:0050768 | negative regulation of neurogenesis | 26147761 |
Tgene | B2M | GO:0090647 | modulation of age-related behavioral decline | 26147761 |
Tgene | B2M | GO:1900121 | negative regulation of receptor binding | 9465039 |
Tgene | B2M | GO:1990000 | amyloid fibril formation | 28468825 |
Tgene | B2M | GO:2000774 | positive regulation of cellular senescence | 28213472 |
Tgene | B2M | GO:2000978 | negative regulation of forebrain neuron differentiation | 26147761 |
Fusion gene breakpoints across AKT1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across B2M (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | THYM | TCGA-X7-A8DF | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Top |
Fusion Gene ORF analysis for AKT1-B2M |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000349310 | ENST00000559220 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
5CDS-intron | ENST00000402615 | ENST00000559220 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
5CDS-intron | ENST00000407796 | ENST00000559220 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
5CDS-intron | ENST00000554581 | ENST00000559220 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
5CDS-intron | ENST00000554848 | ENST00000559220 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
5CDS-intron | ENST00000555528 | ENST00000559220 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000349310 | ENST00000544417 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000349310 | ENST00000558401 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000349310 | ENST00000559916 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000402615 | ENST00000558401 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000402615 | ENST00000559916 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000407796 | ENST00000544417 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000407796 | ENST00000558401 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000407796 | ENST00000559916 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000554581 | ENST00000544417 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000554581 | ENST00000558401 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000554581 | ENST00000559916 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000554848 | ENST00000544417 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000554848 | ENST00000558401 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000554848 | ENST00000559916 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000555528 | ENST00000558401 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000555528 | ENST00000559916 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
In-frame | ENST00000402615 | ENST00000544417 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
In-frame | ENST00000555528 | ENST00000544417 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000544168 | ENST00000544417 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000544168 | ENST00000558401 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000544168 | ENST00000559916 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000554192 | ENST00000544417 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000554192 | ENST00000558401 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000554192 | ENST00000559916 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000554585 | ENST00000544417 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000554585 | ENST00000558401 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000554585 | ENST00000559916 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000555458 | ENST00000544417 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000555458 | ENST00000558401 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000555458 | ENST00000559916 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-intron | ENST00000544168 | ENST00000559220 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-intron | ENST00000554192 | ENST00000559220 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-intron | ENST00000554585 | ENST00000559220 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
intron-intron | ENST00000555458 | ENST00000559220 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000402615 | AKT1 | chr14 | 105258935 | - | ENST00000544417 | B2M | chr15 | 45007621 | + | 2457 | 1527 | 1521 | 616 | 301 |
ENST00000555528 | AKT1 | chr14 | 105258935 | - | ENST00000544417 | B2M | chr15 | 45007621 | + | 1629 | 699 | 259 | 798 | 179 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000402615 | ENST00000544417 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + | 0.644445 | 0.355555 |
ENST00000555528 | ENST00000544417 | AKT1 | chr14 | 105258935 | - | B2M | chr15 | 45007621 | + | 0.41329396 | 0.58670604 |
Top |
Fusion Genomic Features for AKT1-B2M |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
AKT1 | chr14 | 105258934 | - | B2M | chr15 | 45007620 | + | 0.001736733 | 0.9982633 |
AKT1 | chr14 | 105258934 | - | B2M | chr15 | 45007620 | + | 0.001736733 | 0.9982633 |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for AKT1-B2M |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr14:105258935/chr15:45007621) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
AKT1 | B2M |
FUNCTION: AKT1 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis (PubMed:15526160, PubMed:11882383, PubMed:21620960, PubMed:21432781). This is mediated through serine and/or threonine phosphorylation of a range of downstream substrates (PubMed:15526160, PubMed:11882383, PubMed:21620960, PubMed:21432781). Over 100 substrate candidates have been reported so far, but for most of them, no isoform specificity has been reported (PubMed:15526160, PubMed:11882383, PubMed:21620960, PubMed:21432781). AKT is responsible of the regulation of glucose uptake by mediating insulin-induced translocation of the SLC2A4/GLUT4 glucose transporter to the cell surface (By similarity). Phosphorylation of PTPN1 at 'Ser-50' negatively modulates its phosphatase activity preventing dephosphorylation of the insulin receptor and the attenuation of insulin signaling (By similarity). Phosphorylation of TBC1D4 triggers the binding of this effector to inhibitory 14-3-3 proteins, which is required for insulin-stimulated glucose transport (PubMed:11994271). AKT regulates also the storage of glucose in the form of glycogen by phosphorylating GSK3A at 'Ser-21' and GSK3B at 'Ser-9', resulting in inhibition of its kinase activity (By similarity). Phosphorylation of GSK3 isoforms by AKT is also thought to be one mechanism by which cell proliferation is driven (By similarity). AKT regulates also cell survival via the phosphorylation of MAP3K5 (apoptosis signal-related kinase) (PubMed:11154276). Phosphorylation of 'Ser-83' decreases MAP3K5 kinase activity stimulated by oxidative stress and thereby prevents apoptosis (PubMed:11154276). AKT mediates insulin-stimulated protein synthesis by phosphorylating TSC2 at 'Ser-939' and 'Thr-1462', thereby activating mTORC1 signaling and leading to both phosphorylation of 4E-BP1 and in activation of RPS6KB1 (PubMed:12150915). AKT is involved in the phosphorylation of members of the FOXO factors (Forkhead family of transcription factors), leading to binding of 14-3-3 proteins and cytoplasmic localization (PubMed:10358075). In particular, FOXO1 is phosphorylated at 'Thr-24', 'Ser-256' and 'Ser-319' (PubMed:10358075). FOXO3 and FOXO4 are phosphorylated on equivalent sites (PubMed:10358075). AKT has an important role in the regulation of NF-kappa-B-dependent gene transcription and positively regulates the activity of CREB1 (cyclic AMP (cAMP)-response element binding protein) (PubMed:9829964). The phosphorylation of CREB1 induces the binding of accessory proteins that are necessary for the transcription of pro-survival genes such as BCL2 and MCL1 (PubMed:9829964). AKT phosphorylates 'Ser-454' on ATP citrate lyase (ACLY), thereby potentially regulating ACLY activity and fatty acid synthesis (By similarity). Activates the 3B isoform of cyclic nucleotide phosphodiesterase (PDE3B) via phosphorylation of 'Ser-273', resulting in reduced cyclic AMP levels and inhibition of lipolysis (By similarity). Phosphorylates PIKFYVE on 'Ser-318', which results in increased PI(3)P-5 activity (By similarity). The Rho GTPase-activating protein DLC1 is another substrate and its phosphorylation is implicated in the regulation cell proliferation and cell growth. AKT plays a role as key modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including correct neuron positioning, dendritic development and synapse formation (By similarity). Signals downstream of phosphatidylinositol 3-kinase (PI(3)K) to mediate the effects of various growth factors such as platelet-derived growth factor (PDGF), epidermal growth factor (EGF), insulin and insulin-like growth factor I (IGF-I) (PubMed:12176338, PubMed:12964941). AKT mediates the antiapoptotic effects of IGF-I (By similarity). Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly (PubMed:19934221). May be involved in the regulation of the placental development (By similarity). Phosphorylates STK4/MST1 at 'Thr-120' and 'Thr-387' leading to inhibition of its: kinase activity, nuclear translocation, autophosphorylation and ability to phosphorylate FOXO3 (PubMed:17726016). Phosphorylates STK3/MST2 at 'Thr-117' and 'Thr-384' leading to inhibition of its: cleavage, kinase activity, autophosphorylation at Thr-180, binding to RASSF1 and nuclear translocation (PubMed:20086174, PubMed:20231902). Phosphorylates SRPK2 and enhances its kinase activity towards SRSF2 and ACIN1 and promotes its nuclear translocation (PubMed:19592491). Phosphorylates RAF1 at 'Ser-259' and negatively regulates its activity (PubMed:10576742). Phosphorylation of BAD stimulates its pro-apoptotic activity (PubMed:10926925). Phosphorylates KAT6A at 'Thr-369' and this phosphorylation inhibits the interaction of KAT6A with PML and negatively regulates its acetylation activity towards p53/TP53 (PubMed:23431171). Phosphorylates palladin (PALLD), modulating cytoskeletal organization and cell motility (PubMed:20471940). Phosphorylates prohibitin (PHB), playing an important role in cell metabolism and proliferation (PubMed:18507042). Phosphorylates CDKN1A, for which phosphorylation at 'Thr-145' induces its release from CDK2 and cytoplasmic relocalization (PubMed:16982699). These recent findings indicate that the AKT1 isoform has a more specific role in cell motility and proliferation (PubMed:16139227). Phosphorylates CLK2 thereby controlling cell survival to ionizing radiation (PubMed:20682768). Phosphorylates PCK1 at 'Ser-90', reducing the binding affinity of PCK1 to oxaloacetate and changing PCK1 into an atypical protein kinase activity using GTP as donor (PubMed:32322062). {ECO:0000250|UniProtKB:P31750, ECO:0000250|UniProtKB:P47196, ECO:0000269|PubMed:10358075, ECO:0000269|PubMed:10576742, ECO:0000269|PubMed:10926925, ECO:0000269|PubMed:11154276, ECO:0000269|PubMed:11994271, ECO:0000269|PubMed:12150915, ECO:0000269|PubMed:12176338, ECO:0000269|PubMed:12964941, ECO:0000269|PubMed:16139227, ECO:0000269|PubMed:16982699, ECO:0000269|PubMed:17726016, ECO:0000269|PubMed:18507042, ECO:0000269|PubMed:19592491, ECO:0000269|PubMed:19934221, ECO:0000269|PubMed:20086174, ECO:0000269|PubMed:20231902, ECO:0000269|PubMed:20471940, ECO:0000269|PubMed:20682768, ECO:0000269|PubMed:23431171, ECO:0000269|PubMed:32322062, ECO:0000269|PubMed:9829964, ECO:0000303|PubMed:11882383, ECO:0000303|PubMed:15526160, ECO:0000303|PubMed:21432781, ECO:0000303|PubMed:21620960}. | FUNCTION: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. Exogenously applied M.tuberculosis EsxA or EsxA-EsxB (or EsxA expressed in host) binds B2M and decreases its export to the cell surface (total protein levels do not change), probably leading to defects in class I antigen presentation (PubMed:25356553). {ECO:0000269|PubMed:25356553}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | B2M | chr14:105258935 | chr15:45007621 | ENST00000558401 | 0 | 4 | 25_113 | 22 | 498.0 | Domain | Note=Ig-like C1-type | |
Tgene | B2M | chr14:105258935 | chr15:45007621 | ENST00000559916 | 0 | 3 | 25_113 | 22 | 120.0 | Domain | Note=Ig-like C1-type |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000349310 | - | 3 | 15 | 150_408 | 15 | 481.0 | Domain | Protein kinase |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000349310 | - | 3 | 15 | 409_480 | 15 | 481.0 | Domain | AGC-kinase C-terminal |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000349310 | - | 3 | 15 | 5_108 | 15 | 481.0 | Domain | PH |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000402615 | - | 2 | 14 | 150_408 | 15 | 481.0 | Domain | Protein kinase |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000402615 | - | 2 | 14 | 409_480 | 15 | 481.0 | Domain | AGC-kinase C-terminal |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000402615 | - | 2 | 14 | 5_108 | 15 | 481.0 | Domain | PH |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000407796 | - | 2 | 14 | 150_408 | 15 | 481.0 | Domain | Protein kinase |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000407796 | - | 2 | 14 | 409_480 | 15 | 481.0 | Domain | AGC-kinase C-terminal |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000407796 | - | 2 | 14 | 5_108 | 15 | 481.0 | Domain | PH |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554581 | - | 1 | 13 | 150_408 | 15 | 481.0 | Domain | Protein kinase |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554581 | - | 1 | 13 | 409_480 | 15 | 481.0 | Domain | AGC-kinase C-terminal |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554581 | - | 1 | 13 | 5_108 | 15 | 481.0 | Domain | PH |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554848 | - | 2 | 14 | 150_408 | 15 | 481.0 | Domain | Protein kinase |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554848 | - | 2 | 14 | 409_480 | 15 | 481.0 | Domain | AGC-kinase C-terminal |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554848 | - | 2 | 14 | 5_108 | 15 | 481.0 | Domain | PH |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000555528 | - | 2 | 14 | 150_408 | 15 | 481.0 | Domain | Protein kinase |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000555528 | - | 2 | 14 | 409_480 | 15 | 481.0 | Domain | AGC-kinase C-terminal |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000555528 | - | 2 | 14 | 5_108 | 15 | 481.0 | Domain | PH |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000349310 | - | 3 | 15 | 156_164 | 15 | 481.0 | Nucleotide binding | ATP |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000402615 | - | 2 | 14 | 156_164 | 15 | 481.0 | Nucleotide binding | ATP |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000407796 | - | 2 | 14 | 156_164 | 15 | 481.0 | Nucleotide binding | ATP |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554581 | - | 1 | 13 | 156_164 | 15 | 481.0 | Nucleotide binding | ATP |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554848 | - | 2 | 14 | 156_164 | 15 | 481.0 | Nucleotide binding | ATP |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000555528 | - | 2 | 14 | 156_164 | 15 | 481.0 | Nucleotide binding | ATP |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000349310 | - | 3 | 15 | 14_19 | 15 | 481.0 | Region | Note=Inositol-(1%2C3%2C4%2C5)-tetrakisphosphate binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000349310 | - | 3 | 15 | 228_230 | 15 | 481.0 | Region | Note=Inhibitor binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000349310 | - | 3 | 15 | 23_25 | 15 | 481.0 | Region | Note=Inositol-(1%2C3%2C4%2C5)-tetrakisphosphate binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000402615 | - | 2 | 14 | 14_19 | 15 | 481.0 | Region | Note=Inositol-(1%2C3%2C4%2C5)-tetrakisphosphate binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000402615 | - | 2 | 14 | 228_230 | 15 | 481.0 | Region | Note=Inhibitor binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000402615 | - | 2 | 14 | 23_25 | 15 | 481.0 | Region | Note=Inositol-(1%2C3%2C4%2C5)-tetrakisphosphate binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000407796 | - | 2 | 14 | 14_19 | 15 | 481.0 | Region | Note=Inositol-(1%2C3%2C4%2C5)-tetrakisphosphate binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000407796 | - | 2 | 14 | 228_230 | 15 | 481.0 | Region | Note=Inhibitor binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000407796 | - | 2 | 14 | 23_25 | 15 | 481.0 | Region | Note=Inositol-(1%2C3%2C4%2C5)-tetrakisphosphate binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554581 | - | 1 | 13 | 14_19 | 15 | 481.0 | Region | Note=Inositol-(1%2C3%2C4%2C5)-tetrakisphosphate binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554581 | - | 1 | 13 | 228_230 | 15 | 481.0 | Region | Note=Inhibitor binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554581 | - | 1 | 13 | 23_25 | 15 | 481.0 | Region | Note=Inositol-(1%2C3%2C4%2C5)-tetrakisphosphate binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554848 | - | 2 | 14 | 14_19 | 15 | 481.0 | Region | Note=Inositol-(1%2C3%2C4%2C5)-tetrakisphosphate binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554848 | - | 2 | 14 | 228_230 | 15 | 481.0 | Region | Note=Inhibitor binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000554848 | - | 2 | 14 | 23_25 | 15 | 481.0 | Region | Note=Inositol-(1%2C3%2C4%2C5)-tetrakisphosphate binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000555528 | - | 2 | 14 | 14_19 | 15 | 481.0 | Region | Note=Inositol-(1%2C3%2C4%2C5)-tetrakisphosphate binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000555528 | - | 2 | 14 | 228_230 | 15 | 481.0 | Region | Note=Inhibitor binding |
Hgene | AKT1 | chr14:105258935 | chr15:45007621 | ENST00000555528 | - | 2 | 14 | 23_25 | 15 | 481.0 | Region | Note=Inositol-(1%2C3%2C4%2C5)-tetrakisphosphate binding |
Top |
Fusion Gene Sequence for AKT1-B2M |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>3464_3464_1_AKT1-B2M_AKT1_chr14_105258935_ENST00000402615_B2M_chr15_45007621_ENST00000544417_length(transcript)=2457nt_BP=1527nt AAGAATATGTGCTTATGGTAAAGGCAGGCGGCAGGTACGGAGGCTGTGGGAAGTCGGGGTCCCTCCGCCCCCACAGGCAGCCCTGTGCTG GCCTGGTGTATACGTTTCTGTGCAGACGTACACCACCCTGTGTGAGCACAGATGTATTTTTACACATGGCTCTGGACAGCTGTCTGACTC TGTCAGCAGCAGGCCTTGGAGGGGCTCAGGCCCGTGTGGGGGTGGGGGGACATCCAGAGGTCTTTGAGTCCAGCCCTCTGCCTCCAGGCC ACGCCCACTCAGTGTCGTCAGAGCCCCCTGTGCCTGAGGCGTGCGCGGCTCGGAGCCCTGCCCTCGGAGTCCTGCGGTGCCTTCCTCGAG TCTGGCCTGCTTTCCATCCTGCTAAGTACTTGGGGCATTTCCCTCTTTGGGTAAGGTGTGGTCTTCCCTGTCCTGGCATTAGACACAAGG CAGTGGGCCTTCCTGCCATTCTAAGTGTAGCTTAAGACAATCAGTGCAAAGCAACCCTTTGTGGGTGTCCAGCCCTTGCCTCGGGAGGCC AGAAAGGTGGCCTGGGGGGAGAGCGTCTAAGCTGGCTGTGGAAAGACCCATGTTGGGATCCATTCCACAGAGGTCGTCAGGGGTCTCTGC CTGGCCTGGAGGTCCCAGAGAGGACCCTCCTCCCCTCAGGAAGGCCCATCTGGAAGGGTAGCAGAGGACTGCTCACAGGAAGAGCATGCG AAGTGCTCTTTCTGGGGATGCCTGTAGTTGGTGATGTGGGAACTGGGTTTTGAGGGATGCCTAGGAGTTCATCCATCAGAGGGGAAATGA GGAAGCCATGCAGGATCAATGGATAAAGTGTGCTCAGGTGAGGGTTGGCTGGTGGGCCGCTGCAGGGCGGGGGCCTGTCCAGTGCTCCCC CACTTACTTGCTGCCTCCCGACTGCTGTAATTATGGGTCTGTAACCACCCTGGACTGGGTGCTCCTCACTGACGGACTTGTCTGAACCTC TCTTTGTCTCCAGCGCCCAGCACTGGGCCTGGCAAAACCTGAGACGCCCGGTACATGTTGGCCAAATGAATGAACCAGATTCAGACCGGC AGGGGCGCTGTGGTTTAGGAGGGGCCTGGGGTTTCTCCCAGGAGGTTTTTGGGCTTGCGCTGGAGGGCTCTGGACTCCCGTTTGCGCCAG TGGCCTGCATCCTGGTCCTGTCTTCCTCATGTTTGAATTTCTTTGCTTTCCTAGTCTGGGGAGCAGGGAGGAGCCCTGTGCCCTGTCCCA GGATCCATGGGTAGGAACACCATGGACAGGGAGAGCAAACGGGGCCATCTGTCACCAGGGGCTTAGGGAAGGCCGAGCCAGCCTGGGTCA AAGAAGTCAAAGGGGCTGCCTGGAGGAGGCAGCCTGTCAGCTGGTGCATCAGAGGCTGTGGCCAGGCCAGCTGGGCTCGGGGAGCGCCAG CCTGAGAGGAGCGCGTGAGCGTCGCGGGAGCCTCGGGCACCATGAGCGACGTGGCTATTGTGAAGGAGGGTTGGCTGCACAAACGAGGTA CTCCAAAGATTCAGGTTTACTCACGTCATCCAGCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGTGTCTGGGTTTCATCCATCCG ACATTGAAGTTGACTTACTGAAGAATGGAGAGAGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATC TCTTGTACTACACTGAATTCACCCCCACTGAAAAAGATGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTA AGTGGGGTAAGTCTTACATTCTTTTGTAAGCTGCTGAAAGTTGTGTATGAGTAGTCATATCATAAAGCTGCTTTGATATAAAAAAGGTCT ATGGCCATACTACCCTGAATGAGTCCCATCCCATCTGATATAAACAATCTGCATATTGGGATTGTCAGGGAATGTTCTTAAAGATCAGAT TAGTGGCACCTGCTGAGATACTGATGCACAGCATGGTTTCTGAACCAGTAGTTTCCCTGCAGTTGAGCAGGGAGCAGCAGCAGCACTTGC ACAAATACATATACACTCTTAACACTTCTTACCTACTGGCTTCCTCTAGCTTTTGTGGCAGCTTCAGGTATATTTAGCACTGAACGAACA TCTCAAGAAGGTATAGGCCTTTGTTTGTAAGTCCTGCTGTCCTAGCATCCTATAATCCTGGACTTCTCCAGTACTTTCTGGCTGGATTGG TATCTGAGGCTAGTAGGAAGGGCTTGTTCCTGCTGGGTAGCTCTAAACAATGTATTCATGGGTAGGAACAGCAGCCTATTCTGCCAGCCT TATTTCTAACCATTTTAGACATTTGTTAGTACATGGTATTTTAAAAGTAAAACTTAATGTCTTCCTTTTTTTTCTCCACTGTCTTTTTCA >3464_3464_1_AKT1-B2M_AKT1_chr14_105258935_ENST00000402615_B2M_chr15_45007621_ENST00000544417_length(amino acids)=301AA_BP= MCSQPSFTIATSLMVPEAPATLTRSSQAGAPRAQLAWPQPLMHQLTGCLLQAAPLTSLTQAGSAFPKPLVTDGPVCSPCPWCSYPWILGQ GTGLLPAPQTRKAKKFKHEEDRTRMQATGANGSPEPSSASPKTSWEKPQAPPKPQRPCRSESGSFIWPTCTGRLRFCQAQCWALETKRGS DKSVSEEHPVQGGYRPIITAVGRQQVSGGALDRPPPCSGPPANPHLSTLYPLILHGFLISPLMDELLGIPQNPVPTSPTTGIPRKSTSHA -------------------------------------------------------------- >3464_3464_2_AKT1-B2M_AKT1_chr14_105258935_ENST00000555528_B2M_chr15_45007621_ENST00000544417_length(transcript)=1629nt_BP=699nt ATGGATAAAGTGTGCTCAGGTGAGGGTTGGCTGGTGGGCCGCTGCAGGGCGGGGGCCTGTCCAGTGCTCCCCCACTTACTTGCTGCCTCC CGACTGCTGTAATTATGGGTCTGTAACCACCCTGGACTGGGTGCTCCTCACTGACGGACTTGTCTGAACCTCTCTTTGTCTCCAGCGCCC AGCACTGGGCCTGGCAAAACCTGAGACGCCCGGTACATGTTGGCCAAATGAATGAACCAGATTCAGACCGGCAGGGGCGCTGTGGTTTAG GAGGGGCCTGGGGTTTCTCCCAGGAGGTTTTTGGGCTTGCGCTGGAGGGCTCTGGACTCCCGTTTGCGCCAGTGGCCTGCATCCTGGTCC TGTCTTCCTCATGTTTGAATTTCTTTGCTTTCCTAGTCTGGGGAGCAGGGAGGAGCCCTGTGCCCTGTCCCAGGATCCATGGGTAGGAAC ACCATGGACAGGGAGAGCAAACGGGGCCATCTGTCACCAGGGGCTTAGGGAAGGCCGAGCCAGCCTGGGTCAAAGAAGTCAAAGGGGCTG CCTGGAGGAGGCAGCCTGTCAGCTGGTGCATCAGAGGCTGTGGCCAGGCCAGCTGGGCTCGGGGAGCGCCAGCCTGAGAGGAGCGCGTGA GCGTCGCGGGAGCCTCGGGCACCATGAGCGACGTGGCTATTGTGAAGGAGGGTTGGCTGCACAAACGAGGTACTCCAAAGATTCAGGTTT ACTCACGTCATCCAGCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGTGTCTGGGTTTCATCCATCCGACATTGAAGTTGACTTAC TGAAGAATGGAGAGAGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAAT TCACCCCCACTGAAAAAGATGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGGTAAGTCTTACA TTCTTTTGTAAGCTGCTGAAAGTTGTGTATGAGTAGTCATATCATAAAGCTGCTTTGATATAAAAAAGGTCTATGGCCATACTACCCTGA ATGAGTCCCATCCCATCTGATATAAACAATCTGCATATTGGGATTGTCAGGGAATGTTCTTAAAGATCAGATTAGTGGCACCTGCTGAGA TACTGATGCACAGCATGGTTTCTGAACCAGTAGTTTCCCTGCAGTTGAGCAGGGAGCAGCAGCAGCACTTGCACAAATACATATACACTC TTAACACTTCTTACCTACTGGCTTCCTCTAGCTTTTGTGGCAGCTTCAGGTATATTTAGCACTGAACGAACATCTCAAGAAGGTATAGGC CTTTGTTTGTAAGTCCTGCTGTCCTAGCATCCTATAATCCTGGACTTCTCCAGTACTTTCTGGCTGGATTGGTATCTGAGGCTAGTAGGA AGGGCTTGTTCCTGCTGGGTAGCTCTAAACAATGTATTCATGGGTAGGAACAGCAGCCTATTCTGCCAGCCTTATTTCTAACCATTTTAG ACATTTGTTAGTACATGGTATTTTAAAAGTAAAACTTAATGTCTTCCTTTTTTTTCTCCACTGTCTTTTTCATAGATCGAGACATGTAAG >3464_3464_2_AKT1-B2M_AKT1_chr14_105258935_ENST00000555528_B2M_chr15_45007621_ENST00000544417_length(amino acids)=179AA_BP=146 MWFRRGLGFLPGGFWACAGGLWTPVCASGLHPGPVFLMFEFLCFPSLGSREEPCALSQDPWVGTPWTGRANGAICHQGLREGRASLGQRS -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for AKT1-B2M |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for AKT1-B2M |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for AKT1-B2M |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |