|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:ISG15-IFITM1 (FusionGDB2 ID:40301) |
Fusion Gene Summary for ISG15-IFITM1 |
Fusion gene summary |
Fusion gene information | Fusion gene name: ISG15-IFITM1 | Fusion gene ID: 40301 | Hgene | Tgene | Gene symbol | ISG15 | IFITM1 | Gene ID | 9636 | 8519 |
Gene name | ISG15 ubiquitin like modifier | interferon induced transmembrane protein 1 | |
Synonyms | G1P2|IFI15|IMD38|IP17|UCRP|hUCRP | 9-27|CD225|DSPA2a|IFI17|LEU13 | |
Cytomap | 1p36.33 | 11p15.5 | |
Type of gene | protein-coding | protein-coding | |
Description | ubiquitin-like protein ISG15interferon, alpha-inducible protein (clone IFI-15K)interferon-induced 17-kDa/15-kDa proteininterferon-stimulated protein, 15 kDaubiquitin cross-reactive protein | interferon-induced transmembrane protein 1dispanin subfamily A member 2ainterferon-induced protein 17interferon-inducible protein 9-27leu-13 antigen | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | P05161 | A6NMD0 | |
Ensembl transtripts involved in fusion gene | ENST00000379389, | ENST00000525554, ENST00000408968, ENST00000528780, ENST00000328221, | |
Fusion gene scores | * DoF score | 2 X 1 X 1=2 | 7 X 8 X 5=280 |
# samples | 1 | 8 | |
** MAII score | log2(1/2*10)=2.32192809488736 | log2(8/280*10)=-1.8073549220576 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: ISG15 [Title/Abstract] AND IFITM1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | ISG15(949543)-IFITM1(314961), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | ISG15-IFITM1 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ISG15 | GO:0007229 | integrin-mediated signaling pathway | 29100055 |
Hgene | ISG15 | GO:0031397 | negative regulation of protein ubiquitination | 18305167 |
Hgene | ISG15 | GO:0032020 | ISG15-protein conjugation | 16122702|21543490 |
Hgene | ISG15 | GO:0034340 | response to type I interferon | 22859821 |
Hgene | ISG15 | GO:0072608 | interleukin-10 secretion | 29100055 |
Hgene | ISG15 | GO:0072643 | interferon-gamma secretion | 29100055 |
Tgene | IFITM1 | GO:0009615 | response to virus | 21253575|22479637 |
Tgene | IFITM1 | GO:0034341 | response to interferon-gamma | 21253575 |
Tgene | IFITM1 | GO:0035455 | response to interferon-alpha | 22479637 |
Tgene | IFITM1 | GO:0035456 | response to interferon-beta | 21253575 |
Tgene | IFITM1 | GO:0045071 | negative regulation of viral genome replication | 21253575 |
Tgene | IFITM1 | GO:0046597 | negative regulation of viral entry into host cell | 21253575|23358889 |
Fusion gene breakpoints across ISG15 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across IFITM1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | UCEC | TCGA-EY-A1GR-01A | ISG15 | chr1 | 949543 | + | IFITM1 | chr11 | 314961 | + |
Top |
Fusion Gene ORF analysis for ISG15-IFITM1 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000379389 | ENST00000525554 | ISG15 | chr1 | 949543 | + | IFITM1 | chr11 | 314961 | + |
Frame-shift | ENST00000379389 | ENST00000408968 | ISG15 | chr1 | 949543 | + | IFITM1 | chr11 | 314961 | + |
Frame-shift | ENST00000379389 | ENST00000528780 | ISG15 | chr1 | 949543 | + | IFITM1 | chr11 | 314961 | + |
In-frame | ENST00000379389 | ENST00000328221 | ISG15 | chr1 | 949543 | + | IFITM1 | chr11 | 314961 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000379389 | ISG15 | chr1 | 949543 | + | ENST00000328221 | IFITM1 | chr11 | 314961 | + | 810 | 531 | 22 | 468 | 148 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000379389 | ENST00000328221 | ISG15 | chr1 | 949543 | + | IFITM1 | chr11 | 314961 | + | 0.19841786 | 0.80158216 |
Top |
Fusion Genomic Features for ISG15-IFITM1 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for ISG15-IFITM1 |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:949543/chr11:314961) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
ISG15 | IFITM1 |
FUNCTION: Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Its target proteins include IFIT1, MX1/MxA, PPM1B, UBE2L6, UBA7, CHMP5, CHMP2A, CHMP4B and CHMP6. Can also isgylate: EIF2AK2/PKR which results in its activation, DDX58/RIG-I which inhibits its function in antiviral signaling response, EIF4E2 which enhances its cap structure-binding activity and translation-inhibition activity, UBE2N and UBE2E1 which negatively regulates their activity, IRF3 which inhibits its ubiquitination and degradation and FLNB which prevents its ability to interact with the upstream activators of the JNK cascade thereby inhibiting IFNA-induced JNK signaling. Exhibits antiviral activity towards both DNA and RNA viruses, including influenza A, HIV-1 and Ebola virus. Restricts HIV-1 and ebola virus via disruption of viral budding. Inhibits the ubiquitination of HIV-1 Gag and host TSG101 and disrupts their interaction, thereby preventing assembly and release of virions from infected cells. Inhibits Ebola virus budding mediated by the VP40 protein by disrupting ubiquitin ligase activity of NEDD4 and its ability to ubiquitinate VP40. ISGylates influenza A virus NS1 protein which causes a loss of function of the protein and the inhibition of virus replication. The secreted form of ISG15 can: induce natural killer cell proliferation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity. The secreted form acts through the integrin ITGAL/ITGB2 receptor to initiate activation of SRC family tyrosine kinases including LYN, HCK and FGR which leads to secretion of IFNG and IL10; the interaction is mediated by ITGAL (PubMed:29100055). {ECO:0000269|PubMed:1373138, ECO:0000269|PubMed:16009940, ECO:0000269|PubMed:16112642, ECO:0000269|PubMed:16428300, ECO:0000269|PubMed:16434471, ECO:0000269|PubMed:16872604, ECO:0000269|PubMed:18305167, ECO:0000269|PubMed:19270716, ECO:0000269|PubMed:19357168, ECO:0000269|PubMed:2005397, ECO:0000269|PubMed:20133869, ECO:0000269|PubMed:20308324, ECO:0000269|PubMed:20639253, ECO:0000269|PubMed:21543490, ECO:0000269|PubMed:22693631, ECO:0000269|PubMed:22859821, ECO:0000269|PubMed:23229543, ECO:0000269|PubMed:29100055, ECO:0000269|PubMed:7526157, ECO:0000269|PubMed:8550581}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000328221 | 0 | 3 | 37_57 | 0 | 126.0 | Intramembrane | Helical | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000408968 | 0 | 2 | 37_57 | 0 | 126.0 | Intramembrane | Helical | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000528780 | 0 | 3 | 37_57 | 0 | 126.0 | Intramembrane | Helical | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000328221 | 0 | 3 | 108_125 | 0 | 126.0 | Topological domain | Extracellular | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000328221 | 0 | 3 | 1_36 | 0 | 126.0 | Topological domain | Cytoplasmic | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000328221 | 0 | 3 | 58_86 | 0 | 126.0 | Topological domain | Cytoplasmic | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000408968 | 0 | 2 | 108_125 | 0 | 126.0 | Topological domain | Extracellular | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000408968 | 0 | 2 | 1_36 | 0 | 126.0 | Topological domain | Cytoplasmic | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000408968 | 0 | 2 | 58_86 | 0 | 126.0 | Topological domain | Cytoplasmic | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000528780 | 0 | 3 | 108_125 | 0 | 126.0 | Topological domain | Extracellular | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000528780 | 0 | 3 | 1_36 | 0 | 126.0 | Topological domain | Cytoplasmic | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000528780 | 0 | 3 | 58_86 | 0 | 126.0 | Topological domain | Cytoplasmic | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000328221 | 0 | 3 | 87_107 | 0 | 126.0 | Transmembrane | Helical | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000408968 | 0 | 2 | 87_107 | 0 | 126.0 | Transmembrane | Helical | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000528780 | 0 | 3 | 87_107 | 0 | 126.0 | Transmembrane | Helical |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ISG15 | chr1:949543 | chr11:314961 | ENST00000379389 | + | 1 | 2 | 2_78 | 0 | 166.0 | Domain | Ubiquitin-like 1 |
Hgene | ISG15 | chr1:949543 | chr11:314961 | ENST00000379389 | + | 1 | 2 | 79_157 | 0 | 166.0 | Domain | Ubiquitin-like 2 |
Hgene | ISG15 | chr1:949543 | chr11:314961 | ENST00000379389 | + | 1 | 2 | 152_157 | 0 | 166.0 | Motif | Note=LRLRGG |
Hgene | ISG15 | chr1:949543 | chr11:314961 | ENST00000379389 | + | 1 | 2 | 153_157 | 0 | 166.0 | Region | Involved in the ligation of specific target proteins |
Top |
Fusion Gene Sequence for ISG15-IFITM1 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>40301_40301_1_ISG15-IFITM1_ISG15_chr1_949543_ENST00000379389_IFITM1_chr11_314961_ENST00000328221_length(transcript)=810nt_BP=531nt CGCAGGCTCGGCGGCACGCCCCCTGACGTGTGTGCCTCAGGCTTATAATAGGGCCGGTGCTGCCTGCCGAAGCCGGCGGCTGAGAGGCAG CGAACTCATCTTTGCCAGTACAGGAGCTTGTGCCGTGGCCCACAGCCCACAGCCCACAGCCATGAGCCAGGGCCTGGGCCCCGGCAGCAC GGTCCTGCTGGTGGTGGACAAATGCGACGAACCTCTGAGCATCCTGGTGAGGAATAACAAGGGCCGCAGCAGCACCTACGAGGTACGGCT GACGCAGACCGTGGCCCACCTGAAGCAGCAAGTGAGCGGGCTGGAGGGTGTGCAGGACGACCTGTTCTGGCTGACCTTCGAGGGGAAGCC CCTGGAGGACCAGCTCCCGCTGGGGGAGTACGGCCTCAAGCCCCTGAGCACCGTGTTCATGAATCTGCGCCTGCGGGGAGGCGGCACAGA GCCTGGCGGGCGGAGCTAAGGGCCTCCACCAGCATCCGAGCAGGATCAAGGGCCGGAAATAAAGGCTGTTGTAAAGAGAAAAGGCCTATG CCTCCACCGCCAAGTGCCTGAACATCTGGGCCCTGATTCTGGGCATCCTCATGACCATTGGATTCATCCTGTTACTGGTATTCGGCTCTG TGACAGTCTACCATATTATGTTACAGATAATACAGGAAAAACGGGGTTACTAGTAGCCGCCCATAGCCTGCAACCTTTGCACTCCACTGT GCAATGCTGGCCCTGCACGCTGGGGCTGTTGCCCCTGCCCCCTTGGTCCTGCCCCTAGATACAGCAGTTTATACCCACACACCTGTCTAC >40301_40301_1_ISG15-IFITM1_ISG15_chr1_949543_ENST00000379389_IFITM1_chr11_314961_ENST00000328221_length(amino acids)=148AA_BP= MTCVPQAYNRAGAACRSRRLRGSELIFASTGACAVAHSPQPTAMSQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHL -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ISG15-IFITM1 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000328221 | 0 | 3 | 84_125 | 0 | 126.0 | CAV1 | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000408968 | 0 | 2 | 84_125 | 0 | 126.0 | CAV1 | |
Tgene | IFITM1 | chr1:949543 | chr11:314961 | ENST00000528780 | 0 | 3 | 84_125 | 0 | 126.0 | CAV1 |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ISG15-IFITM1 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for ISG15-IFITM1 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |