|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:ITGB3-DYNLRB1 (FusionGDB2 ID:40526) |
Fusion Gene Summary for ITGB3-DYNLRB1 |
Fusion gene summary |
Fusion gene information | Fusion gene name: ITGB3-DYNLRB1 | Fusion gene ID: 40526 | Hgene | Tgene | Gene symbol | ITGB3 | DYNLRB1 | Gene ID | 3690 | 83658 |
Gene name | integrin subunit beta 3 | dynein light chain roadblock-type 1 | |
Synonyms | BDPLT16|BDPLT2|CD61|GP3A|GPIIIa|GT | BITH|BLP|DNCL2A|DNLC2A|ROBLD1 | |
Cytomap | 17q21.32 | 20q11.22 | |
Type of gene | protein-coding | protein-coding | |
Description | integrin beta-3antigen CD61integrin beta 3integrin beta chain, beta 3integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)platelet membrane glycoprotein IIIa | dynein light chain roadblock-type 1ROBL/LC7-like 1bithoraxoid-like proteindynein, cytoplasmic, light polypeptide 2Adynein-associated protein Km23roadblock domain-containing protein 1 | |
Modification date | 20200329 | 20200320 | |
UniProtAcc | P05106 | Q9NP97 | |
Ensembl transtripts involved in fusion gene | ENST00000559488, ENST00000560629, ENST00000571680, ENST00000435993, | ENST00000417166, ENST00000480759, ENST00000300469, ENST00000374846, ENST00000357156, | |
Fusion gene scores | * DoF score | 3 X 2 X 2=12 | 17 X 12 X 12=2448 |
# samples | 4 | 23 | |
** MAII score | log2(4/12*10)=1.73696559416621 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(23/2448*10)=-3.41189779174828 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: ITGB3 [Title/Abstract] AND DYNLRB1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | ITGB3(45331306)-DYNLRB1(33122431), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | ITGB3-DYNLRB1 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. ITGB3-DYNLRB1 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. ITGB3-DYNLRB1 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ITGB3 | GO:0033627 | cell adhesion mediated by integrin | 12807887 |
Hgene | ITGB3 | GO:0034446 | substrate adhesion-dependent cell spreading | 24658351 |
Hgene | ITGB3 | GO:0099149 | regulation of postsynaptic neurotransmitter receptor internalization | 18549786 |
Fusion gene breakpoints across ITGB3 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across DYNLRB1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | OV | TCGA-24-1103 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
Top |
Fusion Gene ORF analysis for ITGB3-DYNLRB1 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-3UTR | ENST00000559488 | ENST00000417166 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5CDS-3UTR | ENST00000559488 | ENST00000480759 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5CDS-3UTR | ENST00000560629 | ENST00000417166 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5CDS-3UTR | ENST00000560629 | ENST00000480759 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5CDS-3UTR | ENST00000571680 | ENST00000417166 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5CDS-3UTR | ENST00000571680 | ENST00000480759 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5CDS-intron | ENST00000559488 | ENST00000300469 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5CDS-intron | ENST00000559488 | ENST00000374846 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5CDS-intron | ENST00000560629 | ENST00000300469 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5CDS-intron | ENST00000560629 | ENST00000374846 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5CDS-intron | ENST00000571680 | ENST00000300469 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5CDS-intron | ENST00000571680 | ENST00000374846 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5UTR-3CDS | ENST00000435993 | ENST00000357156 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5UTR-3UTR | ENST00000435993 | ENST00000417166 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5UTR-3UTR | ENST00000435993 | ENST00000480759 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5UTR-intron | ENST00000435993 | ENST00000300469 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
5UTR-intron | ENST00000435993 | ENST00000374846 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
Frame-shift | ENST00000560629 | ENST00000357156 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
In-frame | ENST00000559488 | ENST00000357156 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
In-frame | ENST00000571680 | ENST00000357156 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000559488 | ITGB3 | chr17 | 45331306 | + | ENST00000357156 | DYNLRB1 | chr20 | 33122431 | + | 641 | 95 | 369 | 1 | 123 |
ENST00000571680 | ITGB3 | chr17 | 45331306 | + | ENST00000357156 | DYNLRB1 | chr20 | 33122431 | + | 634 | 88 | 362 | 0 | 121 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000559488 | ENST00000357156 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + | 0.1437805 | 0.8562195 |
ENST00000571680 | ENST00000357156 | ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + | 0.13756448 | 0.86243546 |
Top |
Fusion Genomic Features for ITGB3-DYNLRB1 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + | 6.34E-10 | 1 |
ITGB3 | chr17 | 45331306 | + | DYNLRB1 | chr20 | 33122431 | + | 6.34E-10 | 1 |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for ITGB3-DYNLRB1 |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr17:45331306/chr20:33122431) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
ITGB3 | DYNLRB1 |
FUNCTION: Integrin alpha-V/beta-3 (ITGAV:ITGB3) is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin alpha-IIb/beta-3 (ITGA2B:ITGB3) is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. Integrins alpha-IIb/beta-3 and alpha-V/beta-3 recognize the sequence R-G-D in a wide array of ligands. Integrin alpha-IIb/beta-3 recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. Fibrinogen binding enhances SELP expression in activated platelets (By similarity). ITGAV:ITGB3 binds to fractalkine (CX3CL1) and acts as its coreceptor in CX3CR1-dependent fractalkine signaling (PubMed:23125415, PubMed:24789099). ITGAV:ITGB3 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling (PubMed:20682778). ITGAV:ITGB3 binds to FGF1 and this binding is essential for FGF1 signaling (PubMed:18441324). ITGAV:ITGB3 binds to FGF2 and this binding is essential for FGF2 signaling (PubMed:28302677). ITGAV:ITGB3 binds to IGF1 and this binding is essential for IGF1 signaling (PubMed:19578119). ITGAV:ITGB3 binds to IGF2 and this binding is essential for IGF2 signaling (PubMed:28873464). ITGAV:ITGB3 binds to IL1B and this binding is essential for IL1B signaling (PubMed:29030430). ITGAV:ITGB3 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed:18635536, PubMed:25398877). ITGAV:ITGB3 acts as a receptor for fibrillin-1 (FBN1) and mediates R-G-D-dependent cell adhesion to FBN1 (PubMed:12807887). In brain, plays a role in synaptic transmission and plasticity. Involved in the regulation of the serotonin neurotransmission, is required to localize to specific compartments within the synapse the serotonin receptor SLC6A4 and for an appropriate reuptake of serotonin. Controls excitatory synaptic strength by regulating GRIA2-containing AMPAR endocytosis, which affects AMPAR abundance and composition (By similarity). ITGAV:ITGB3 act as a receptor for CD40LG (PubMed:31331973). {ECO:0000250|UniProtKB:O54890, ECO:0000269|PubMed:12807887, ECO:0000269|PubMed:18441324, ECO:0000269|PubMed:18635536, ECO:0000269|PubMed:19578119, ECO:0000269|PubMed:20682778, ECO:0000269|PubMed:23125415, ECO:0000269|PubMed:24789099, ECO:0000269|PubMed:25398877, ECO:0000269|PubMed:28302677, ECO:0000269|PubMed:28873464, ECO:0000269|PubMed:29030430, ECO:0000269|PubMed:31331973, ECO:0000269|PubMed:9195946, ECO:0000303|PubMed:16322781, ECO:0000303|PubMed:17635696}.; FUNCTION: (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Herpes virus 8/HHV-8. {ECO:0000269|PubMed:18045938}.; FUNCTION: (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Coxsackievirus A9. {ECO:0000269|PubMed:7519807}.; FUNCTION: (Microbial infection) Acts as a receptor for Hantaan virus. {ECO:0000269|PubMed:9618541}.; FUNCTION: (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Cytomegalovirus/HHV-5. {ECO:0000269|PubMed:15834425}.; FUNCTION: (Microbial infection) Integrin ITGA5:ITGB3 acts as a receptor for Human metapneumovirus. {ECO:0000269|PubMed:24478423}.; FUNCTION: (Microbial infection) Integrin ITGAV:ITGB3 acts aP05556s a receptor for Human parechovirus 1. {ECO:0000269|PubMed:11160695}.; FUNCTION: (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for West nile virus. {ECO:0000269|PubMed:23658209}.; FUNCTION: (Microbial infection) In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. {ECO:0000269|PubMed:10397733}. | FUNCTION: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ITGB3 | chr17:45331306 | chr20:33122431 | ENST00000559488 | + | 1 | 15 | 135_377 | 26 | 789.0 | Domain | Note=VWFA |
Hgene | ITGB3 | chr17:45331306 | chr20:33122431 | ENST00000559488 | + | 1 | 15 | 777_783 | 26 | 789.0 | Motif | LIR |
Hgene | ITGB3 | chr17:45331306 | chr20:33122431 | ENST00000559488 | + | 1 | 15 | 293_313 | 26 | 789.0 | Region | CX3CL1-binding |
Hgene | ITGB3 | chr17:45331306 | chr20:33122431 | ENST00000559488 | + | 1 | 15 | 463_629 | 26 | 789.0 | Region | Note=Cysteine-rich tandem repeats |
Hgene | ITGB3 | chr17:45331306 | chr20:33122431 | ENST00000559488 | + | 1 | 15 | 463_511 | 26 | 789.0 | Repeat | Note=I |
Hgene | ITGB3 | chr17:45331306 | chr20:33122431 | ENST00000559488 | + | 1 | 15 | 512_553 | 26 | 789.0 | Repeat | Note=II |
Hgene | ITGB3 | chr17:45331306 | chr20:33122431 | ENST00000559488 | + | 1 | 15 | 554_592 | 26 | 789.0 | Repeat | Note=III |
Hgene | ITGB3 | chr17:45331306 | chr20:33122431 | ENST00000559488 | + | 1 | 15 | 593_629 | 26 | 789.0 | Repeat | Note=IV |
Hgene | ITGB3 | chr17:45331306 | chr20:33122431 | ENST00000559488 | + | 1 | 15 | 27_718 | 26 | 789.0 | Topological domain | Extracellular |
Hgene | ITGB3 | chr17:45331306 | chr20:33122431 | ENST00000559488 | + | 1 | 15 | 742_788 | 26 | 789.0 | Topological domain | Cytoplasmic |
Hgene | ITGB3 | chr17:45331306 | chr20:33122431 | ENST00000559488 | + | 1 | 15 | 719_741 | 26 | 789.0 | Transmembrane | Helical |
Top |
Fusion Gene Sequence for ITGB3-DYNLRB1 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>40526_40526_1_ITGB3-DYNLRB1_ITGB3_chr17_45331306_ENST00000559488_DYNLRB1_chr20_33122431_ENST00000357156_length(transcript)=641nt_BP=95nt GCGGGAGGCGGACGAGATGCGAGCGCGGCCGCGGCCCCGGCCGCTCTGGGCGACTGTGCTGGCGCTGGGGGCGCTGGCGGGCGTTGGCGT AGGAGGCATTCCCATCAAGAGCACCATGGACAACCCCACCACCACCCAGTATGCCAGCCTCATGCACAGCTTCATCCTGAAGGCACGGAG CACCGTGCGTGACATCGACCCCCAGAACGATCTCACCTTCCTTCGAATTCGCTCCAAGAAAAATGAAATTATGGTTGCACCAGATAAAGA CTATTTCCTGATTGTGATTCAGAATCCAACCGAATAAGCCACTCTCTTGGCTCCCTGTGTCATTCCTTAATTTAATGCCCCCCAAGAATG TTAATGTCAATCATGTCAGTGGACTAGCACATGGCAGTCGCTTGGAACCCACTCACACCAATCCAGTGACCGTGTGTGGGCTGGCGGCTC TTCTCCCCCACCAACGGAACCCCTGTGTGCACCAACCTTCCCCAGAGCTCCGGAGCGCCCTCTCCTCACTTCCAGGTTTTGGAGCAAGAG CTTGCAGGAAGCCCGCACCCAGCTTCCTTCTGACCTTCAGTTCACTTTGTCGCCCTTGGAGAAAGCTGTTTTTCTTTAACTAAAAATAAC >40526_40526_1_ITGB3-DYNLRB1_ITGB3_chr17_45331306_ENST00000559488_DYNLRB1_chr20_33122431_ENST00000357156_length(amino acids)=123AA_BP=1 MTLTFLGGIKLRNDTGSQESGLFGWILNHNQEIVFIWCNHNFIFLGANSKEGEIVLGVDVTHGAPCLQDEAVHEAGILGGGGVVHGALDG -------------------------------------------------------------- >40526_40526_2_ITGB3-DYNLRB1_ITGB3_chr17_45331306_ENST00000571680_DYNLRB1_chr20_33122431_ENST00000357156_length(transcript)=634nt_BP=88nt GCGGACGAGATGCGAGCGCGGCCGCGGCCCCGGCCGCTCTGGGCGACTGTGCTGGCGCTGGGGGCGCTGGCGGGCGTTGGCGTAGGAGGC ATTCCCATCAAGAGCACCATGGACAACCCCACCACCACCCAGTATGCCAGCCTCATGCACAGCTTCATCCTGAAGGCACGGAGCACCGTG CGTGACATCGACCCCCAGAACGATCTCACCTTCCTTCGAATTCGCTCCAAGAAAAATGAAATTATGGTTGCACCAGATAAAGACTATTTC CTGATTGTGATTCAGAATCCAACCGAATAAGCCACTCTCTTGGCTCCCTGTGTCATTCCTTAATTTAATGCCCCCCAAGAATGTTAATGT CAATCATGTCAGTGGACTAGCACATGGCAGTCGCTTGGAACCCACTCACACCAATCCAGTGACCGTGTGTGGGCTGGCGGCTCTTCTCCC CCACCAACGGAACCCCTGTGTGCACCAACCTTCCCCAGAGCTCCGGAGCGCCCTCTCCTCACTTCCAGGTTTTGGAGCAAGAGCTTGCAG GAAGCCCGCACCCAGCTTCCTTCTGACCTTCAGTTCACTTTGTCGCCCTTGGAGAAAGCTGTTTTTCTTTAACTAAAAATAACCAAAATG >40526_40526_2_ITGB3-DYNLRB1_ITGB3_chr17_45331306_ENST00000571680_DYNLRB1_chr20_33122431_ENST00000357156_length(amino acids)=121AA_BP=1 MTLTFLGGIKLRNDTGSQESGLFGWILNHNQEIVFIWCNHNFIFLGANSKEGEIVLGVDVTHGAPCLQDEAVHEAGILGGGGVVHGALDG -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ITGB3-DYNLRB1 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ITGB3-DYNLRB1 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for ITGB3-DYNLRB1 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |