|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:LIN7A-NUP107 (FusionGDB2 ID:44775) |
Fusion Gene Summary for LIN7A-NUP107 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: LIN7A-NUP107 | Fusion gene ID: 44775 | Hgene | Tgene | Gene symbol | LIN7A | NUP107 | Gene ID | 8825 | 57122 |
| Gene name | lin-7 homolog A, crumbs cell polarity complex component | nucleoporin 107 | |
| Synonyms | LIN-7A|LIN7|MALS-1|MALS1|TIP-33|VELI1 | NPHS11|NUP84|ODG6|ODG6; GAMOS7 | |
| Cytomap | 12q21.31 | 12q15 | |
| Type of gene | protein-coding | protein-coding | |
| Description | protein lin-7 homolog Amammalian lin-seven protein 1tax interaction protein 33vertebrate LIN7 homolog 1 | nuclear pore complex protein Nup107nucleoporin 107kDa | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | O14910 | P57740 | |
| Ensembl transtripts involved in fusion gene | ENST00000552864, | ENST00000401003, ENST00000229179, ENST00000378905, ENST00000539906, | |
| Fusion gene scores | * DoF score | 9 X 4 X 3=108 | 27 X 22 X 9=5346 |
| # samples | 8 | 37 | |
| ** MAII score | log2(8/108*10)=-0.432959407276106 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(37/5346*10)=-3.85286266172677 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: LIN7A [Title/Abstract] AND NUP107 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | LIN7A(81283030)-NUP107(69135593), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | |||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | NUP107 | GO:0006406 | mRNA export from nucleus | 11684705 |
| Fusion gene breakpoints across LIN7A (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across NUP107 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | SARC | TCGA-3B-A9HO-01A | LIN7A | chr12 | 81283030 | - | NUP107 | chr12 | 69135593 | + |
Top |
Fusion Gene ORF analysis for LIN7A-NUP107 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| 5CDS-intron | ENST00000552864 | ENST00000401003 | LIN7A | chr12 | 81283030 | - | NUP107 | chr12 | 69135593 | + |
| In-frame | ENST00000552864 | ENST00000229179 | LIN7A | chr12 | 81283030 | - | NUP107 | chr12 | 69135593 | + |
| In-frame | ENST00000552864 | ENST00000378905 | LIN7A | chr12 | 81283030 | - | NUP107 | chr12 | 69135593 | + |
| In-frame | ENST00000552864 | ENST00000539906 | LIN7A | chr12 | 81283030 | - | NUP107 | chr12 | 69135593 | + |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000552864 | LIN7A | chr12 | 81283030 | - | ENST00000229179 | NUP107 | chr12 | 69135593 | + | 1223 | 404 | 53 | 679 | 208 |
| ENST00000552864 | LIN7A | chr12 | 81283030 | - | ENST00000378905 | NUP107 | chr12 | 69135593 | + | 901 | 404 | 53 | 679 | 208 |
| ENST00000552864 | LIN7A | chr12 | 81283030 | - | ENST00000539906 | NUP107 | chr12 | 69135593 | + | 749 | 404 | 53 | 679 | 208 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000552864 | ENST00000229179 | LIN7A | chr12 | 81283030 | - | NUP107 | chr12 | 69135593 | + | 0.002053325 | 0.9979467 |
| ENST00000552864 | ENST00000378905 | LIN7A | chr12 | 81283030 | - | NUP107 | chr12 | 69135593 | + | 0.003388239 | 0.9966118 |
| ENST00000552864 | ENST00000539906 | LIN7A | chr12 | 81283030 | - | NUP107 | chr12 | 69135593 | + | 0.005922304 | 0.9940777 |
Top |
Fusion Genomic Features for LIN7A-NUP107 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| LIN7A | chr12 | 81283029 | - | NUP107 | chr12 | 69135592 | + | 6.43E-06 | 0.99999356 |
| LIN7A | chr12 | 81283029 | - | NUP107 | chr12 | 69135592 | + | 6.43E-06 | 0.99999356 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
 |
Top |
Fusion Protein Features for LIN7A-NUP107 |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr12:81283030/chr12:69135593) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| LIN7A | NUP107 |
| FUNCTION: Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 associates with the motor protein KIF17 to transport vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules (By similarity). This complex may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells. {ECO:0000250|UniProtKB:Q8JZS0, ECO:0000269|PubMed:12967566}. | FUNCTION: Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance (PubMed:12552102, PubMed:15229283, PubMed:30179222). Required for the assembly of peripheral proteins into the NPC (PubMed:15229283, PubMed:12552102). May anchor NUP62 to the NPC (PubMed:15229283). Involved in nephrogenesis (PubMed:30179222). {ECO:0000269|PubMed:12552102, ECO:0000269|PubMed:15229283, ECO:0000269|PubMed:30179222}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | LIN7A | chr12:81283030 | chr12:69135593 | ENST00000552864 | - | 2 | 6 | 14_28 | 67 | 1908.0 | Motif | Note=Kinase interacting site |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | LIN7A | chr12:81283030 | chr12:69135593 | ENST00000552864 | - | 2 | 6 | 210_213 | 67 | 1908.0 | Compositional bias | Note=Poly-Gln |
| Hgene | LIN7A | chr12:81283030 | chr12:69135593 | ENST00000552864 | - | 2 | 6 | 217_229 | 67 | 1908.0 | Compositional bias | Note=Poly-Gln |
| Hgene | LIN7A | chr12:81283030 | chr12:69135593 | ENST00000552864 | - | 2 | 6 | 108_190 | 67 | 1908.0 | Domain | PDZ |
| Hgene | LIN7A | chr12:81283030 | chr12:69135593 | ENST00000552864 | - | 2 | 6 | 25_80 | 67 | 1908.0 | Domain | L27 |
Top |
Fusion Gene Sequence for LIN7A-NUP107 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >44775_44775_1_LIN7A-NUP107_LIN7A_chr12_81283030_ENST00000552864_NUP107_chr12_69135593_ENST00000229179_length(transcript)=1223nt_BP=404nt CGGATACCTGCTCAGCTCCGCACCGCAACTGAAGATCTGCCGCCGCGGAACAGTTGCGTCTCCATCTGGCTACCAACCCACCCAAGCTTT CTTCTCCACCACCACCACCTTCCTTCCTTCCCCCTCCTCCCCCTCCTTTCCGTCTTCCCTCTCCACCCCCGCCCCCAATCTCCTCCTTTT TTTCTCACTACGAGCGGTTGCTGATGCTGAAGCCGAGCGTCACTTCGGCTCCCACGGCAGACATGGCGACATTGACAGTGGTCCAGCCGC TCACCCTGGACAGAGATGTTGCAAGAGCAATTGAATTACTGGAAAAACTACAGGAATCTGGAGAAGTACCAGTGCACAAGCTACAATCCC TCAAAAAAGTGCTTCAGAGTGAGTTTTGTACAGCTATTCGAGAGGATGCCAAAGAAGACCATGAAAGAACACATCAAATGGTCTTACTGA GAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGTCAGTATCAGGAATGCCTACAGTTAGCAGATA TGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTGCTGCAGAAGCTCAGAGAGTCCTCTCTAA TGCTCCTAGACCAGGGACTTGACCCATTAGGGTATGAAATTCAGTTATAGTTTAATCTTTGTAATCTCACTAATTTTCATGATAAATGAA GTTTTTAATAAAATATACTTGTTATTAGTAATTTTTTCTTTTGCATTACCATGTAAAATTTAGACATTTGAATTTTGTACTTTTCAGAAT ATTATCGTGACACTTTCAACATGTAGGGATATCAGCGTTTCTCTGTGTGCTTGTTAATAAAACTATATAAAAATTAAAATTTTCTGTTTT TACAAATTCCAGGGTTGTCTCTTTTTCATGTAATAAGAAAATTAAATTTTCTGTTCTAGTTTTTTCTGTAATCATAAGCATTCTGATATT TTAAAATCATAAAGATGATGGAAAGTAGATTTATTTTTAAGCCAGGTACGTAATTTTTTATTTATCATAAAATTTAGTATTTTTGAATAT TAAAATTAAGAAGATGACTATAACAAGAATTTTTCTAACATAACATGCTATTATTATTTTAGTTATTTTGAAGACATTTCTAGTTTAACT >44775_44775_1_LIN7A-NUP107_LIN7A_chr12_81283030_ENST00000552864_NUP107_chr12_69135593_ENST00000229179_length(amino acids)=208AA_BP=98 MRLHLATNPPKLSSPPPPPSFLPPPPPPFRLPSPPPPPISSFFSHYERLLMLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQ ESGEVPVHKLQSLKKVLQSEFCTAIREDAKEDHERTHQMVLLRKLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEEL -------------------------------------------------------------- >44775_44775_2_LIN7A-NUP107_LIN7A_chr12_81283030_ENST00000552864_NUP107_chr12_69135593_ENST00000378905_length(transcript)=901nt_BP=404nt CGGATACCTGCTCAGCTCCGCACCGCAACTGAAGATCTGCCGCCGCGGAACAGTTGCGTCTCCATCTGGCTACCAACCCACCCAAGCTTT CTTCTCCACCACCACCACCTTCCTTCCTTCCCCCTCCTCCCCCTCCTTTCCGTCTTCCCTCTCCACCCCCGCCCCCAATCTCCTCCTTTT TTTCTCACTACGAGCGGTTGCTGATGCTGAAGCCGAGCGTCACTTCGGCTCCCACGGCAGACATGGCGACATTGACAGTGGTCCAGCCGC TCACCCTGGACAGAGATGTTGCAAGAGCAATTGAATTACTGGAAAAACTACAGGAATCTGGAGAAGTACCAGTGCACAAGCTACAATCCC TCAAAAAAGTGCTTCAGAGTGAGTTTTGTACAGCTATTCGAGAGGATGCCAAAGAAGACCATGAAAGAACACATCAAATGGTCTTACTGA GAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGTCAGTATCAGGAATGCCTACAGTTAGCAGATA TGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTGCTGCAGAAGCTCAGAGAGTCCTCTCTAA TGCTCCTAGACCAGGGACTTGACCCATTAGGGTATGAAATTCAGTTATAGTTTAATCTTTGTAATCTCACTAATTTTCATGATAAATGAA GTTTTTAATAAAATATACTTGTTATTAGTAATTTTTTCTTTTGCATTACCATGTAAAATTTAGACATTTGAATTTTGTACTTTTCAGAAT ATTATCGTGACACTTTCAACATGTAGGGATATCAGCGTTTCTCTGTGTGCTTGTTAATAAAACTATATAAAAATTAAAATTTTCTGTTTT >44775_44775_2_LIN7A-NUP107_LIN7A_chr12_81283030_ENST00000552864_NUP107_chr12_69135593_ENST00000378905_length(amino acids)=208AA_BP=98 MRLHLATNPPKLSSPPPPPSFLPPPPPPFRLPSPPPPPISSFFSHYERLLMLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQ ESGEVPVHKLQSLKKVLQSEFCTAIREDAKEDHERTHQMVLLRKLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEEL -------------------------------------------------------------- >44775_44775_3_LIN7A-NUP107_LIN7A_chr12_81283030_ENST00000552864_NUP107_chr12_69135593_ENST00000539906_length(transcript)=749nt_BP=404nt CGGATACCTGCTCAGCTCCGCACCGCAACTGAAGATCTGCCGCCGCGGAACAGTTGCGTCTCCATCTGGCTACCAACCCACCCAAGCTTT CTTCTCCACCACCACCACCTTCCTTCCTTCCCCCTCCTCCCCCTCCTTTCCGTCTTCCCTCTCCACCCCCGCCCCCAATCTCCTCCTTTT TTTCTCACTACGAGCGGTTGCTGATGCTGAAGCCGAGCGTCACTTCGGCTCCCACGGCAGACATGGCGACATTGACAGTGGTCCAGCCGC TCACCCTGGACAGAGATGTTGCAAGAGCAATTGAATTACTGGAAAAACTACAGGAATCTGGAGAAGTACCAGTGCACAAGCTACAATCCC TCAAAAAAGTGCTTCAGAGTGAGTTTTGTACAGCTATTCGAGAGGATGCCAAAGAAGACCATGAAAGAACACATCAAATGGTCTTACTGA GAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGTCAGTATCAGGAATGCCTACAGTTAGCAGATA TGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTGCTGCAGAAGCTCAGAGAGTCCTCTCTAA TGCTCCTAGACCAGGGACTTGACCCATTAGGGTATGAAATTCAGTTATAGTTTAATCTTTGTAATCTCACTAATTTTCATGATAAATGAA >44775_44775_3_LIN7A-NUP107_LIN7A_chr12_81283030_ENST00000552864_NUP107_chr12_69135593_ENST00000539906_length(amino acids)=208AA_BP=98 MRLHLATNPPKLSSPPPPPSFLPPPPPPFRLPSPPPPPISSFFSHYERLLMLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQ ESGEVPVHKLQSLKKVLQSEFCTAIREDAKEDHERTHQMVLLRKLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEEL -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for LIN7A-NUP107 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for LIN7A-NUP107 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for LIN7A-NUP107 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies