|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:LRIG3-DTX3 (FusionGDB2 ID:49694) |
Fusion Gene Summary for LRIG3-DTX3 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: LRIG3-DTX3 | Fusion gene ID: 49694 | Hgene | Tgene | Gene symbol | LRIG3 | DTX3 | Gene ID | 121227 | 196403 |
| Gene name | leucine rich repeats and immunoglobulin like domains 3 | deltex E3 ubiquitin ligase 3 | |
| Synonyms | LIG3 | RNF154|deltex3 | |
| Cytomap | 12q14.1 | 12q13.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | leucine-rich repeats and immunoglobulin-like domains protein 3LIG-3 | probable E3 ubiquitin-protein ligase DTX3RING finger protein 154RING-type E3 ubiquitin transferase DTX3deltex 3, E3 ubiquitin ligasedeltex homolog 3protein deltex-3 | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q6UXM1 | Q8TDB6 | |
| Ensembl transtripts involved in fusion gene | ENST00000320743, ENST00000379141, | ENST00000337737, ENST00000548198, ENST00000548804, ENST00000551632, | |
| Fusion gene scores | * DoF score | 10 X 8 X 8=640 | 5 X 6 X 4=120 |
| # samples | 12 | 7 | |
| ** MAII score | log2(12/640*10)=-2.41503749927884 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(7/120*10)=-0.777607578663552 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: LRIG3 [Title/Abstract] AND DTX3 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | LRIG3(59307763)-DTX3(58002860), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | LRIG3-DTX3 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. LRIG3-DTX3 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. LRIG3-DTX3 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Fusion gene breakpoints across LRIG3 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across DTX3 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BRCA | TCGA-AR-A1AH-01A | LRIG3 | chr12 | 59307763 | - | DTX3 | chr12 | 58002860 | + |
Top |
Fusion Gene ORF analysis for LRIG3-DTX3 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| Frame-shift | ENST00000320743 | ENST00000337737 | LRIG3 | chr12 | 59307763 | - | DTX3 | chr12 | 58002860 | + |
| Frame-shift | ENST00000320743 | ENST00000548198 | LRIG3 | chr12 | 59307763 | - | DTX3 | chr12 | 58002860 | + |
| Frame-shift | ENST00000320743 | ENST00000548804 | LRIG3 | chr12 | 59307763 | - | DTX3 | chr12 | 58002860 | + |
| Frame-shift | ENST00000379141 | ENST00000337737 | LRIG3 | chr12 | 59307763 | - | DTX3 | chr12 | 58002860 | + |
| Frame-shift | ENST00000379141 | ENST00000548198 | LRIG3 | chr12 | 59307763 | - | DTX3 | chr12 | 58002860 | + |
| Frame-shift | ENST00000379141 | ENST00000548804 | LRIG3 | chr12 | 59307763 | - | DTX3 | chr12 | 58002860 | + |
| In-frame | ENST00000320743 | ENST00000551632 | LRIG3 | chr12 | 59307763 | - | DTX3 | chr12 | 58002860 | + |
| In-frame | ENST00000379141 | ENST00000551632 | LRIG3 | chr12 | 59307763 | - | DTX3 | chr12 | 58002860 | + |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000379141 | LRIG3 | chr12 | 59307763 | - | ENST00000551632 | DTX3 | chr12 | 58002860 | + | 995 | 267 | 567 | 139 | 142 |
| ENST00000320743 | LRIG3 | chr12 | 59307763 | - | ENST00000551632 | DTX3 | chr12 | 58002860 | + | 1398 | 670 | 221 | 745 | 174 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000379141 | ENST00000551632 | LRIG3 | chr12 | 59307763 | - | DTX3 | chr12 | 58002860 | + | 0.44930187 | 0.55069816 |
| ENST00000320743 | ENST00000551632 | LRIG3 | chr12 | 59307763 | - | DTX3 | chr12 | 58002860 | + | 0.58487296 | 0.415127 |
Top |
Fusion Genomic Features for LRIG3-DTX3 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| LRIG3 | chr12 | 59307762 | - | DTX3 | chr12 | 58002859 | + | 0.001276572 | 0.99872345 |
| LRIG3 | chr12 | 59307762 | - | DTX3 | chr12 | 58002859 | + | 0.001276572 | 0.99872345 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
 |
Top |
Fusion Protein Features for LRIG3-DTX3 |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr12:59307763/chr12:58002860) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| LRIG3 | DTX3 |
| FUNCTION: May play a role in craniofacial and inner ear morphogenesis during embryonic development. May act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1 (By similarity). {ECO:0000250}. | FUNCTION: E3 ubiquitin-protein ligase which, in association with ADP-ribosyltransferase PARP9, plays a role in DNA damage repair and in interferon-mediated antiviral responses (PubMed:12670957, PubMed:19818714, PubMed:26479788, PubMed:23230272). Monoubiquitinates several histones, including histone H2A, H2B, H3 and H4 (PubMed:28525742). In response to DNA damage, mediates monoubiquitination of 'Lys-91' of histone H4 (H4K91ub1) (PubMed:19818714). The exact role of H4K91ub1 in DNA damage response is still unclear but it may function as a licensing signal for additional histone H4 post-translational modifications such as H4 'Lys-20' methylation (H4K20me) (PubMed:19818714). PARP1-dependent PARP9-DTX3L-mediated ubiquitination promotes the rapid and specific recruitment of 53BP1/TP53BP1, UIMC1/RAP80, and BRCA1 to DNA damage sites (PubMed:23230272). By monoubiquitinating histone H2B H2BC9/H2BJ and thereby promoting chromatin remodeling, positively regulates STAT1-dependent interferon-stimulated gene transcription and thus STAT1-mediated control of viral replication (PubMed:26479788). Independently of its catalytic activity, promotes the sorting of chemokine receptor CXCR4 from early endosome to lysosome following CXCL12 stimulation by reducing E3 ligase ITCH activity and thus ITCH-mediated ubiquitination of endosomal sorting complex required for transport ESCRT-0 components HGS and STAM (PubMed:24790097). In addition, required for the recruitment of HGS and STAM to early endosomes (PubMed:24790097). In association with PARP9, plays a role in antiviral responses by mediating 'Lys-48'-linked ubiquitination of encephalomyocarditis virus (EMCV) and human rhinovirus (HRV) C3 proteases and thus promoting their proteosomal-mediated degradation (PubMed:26479788). {ECO:0000269|PubMed:12670957, ECO:0000269|PubMed:19818714, ECO:0000269|PubMed:23230272, ECO:0000269|PubMed:24790097, ECO:0000269|PubMed:26479788, ECO:0000269|PubMed:28525742}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 38_74 | 127 | 1120.0 | Domain | Note=LRRNT |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 75_96 | 127 | 1120.0 | Repeat | Note=LRR 1 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 99_120 | 127 | 1120.0 | Repeat | Note=LRR 2 |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 444_495 | 127 | 1120.0 | Domain | Note=LRRCT |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 499_598 | 127 | 1120.0 | Domain | Note=Ig-like C2-type 1 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 603_692 | 127 | 1120.0 | Domain | Note=Ig-like C2-type 2 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 697_783 | 127 | 1120.0 | Domain | Note=Ig-like C2-type 3 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 38_74 | 67 | 1060.0 | Domain | Note=LRRNT |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 444_495 | 67 | 1060.0 | Domain | Note=LRRCT |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 499_598 | 67 | 1060.0 | Domain | Note=Ig-like C2-type 1 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 603_692 | 67 | 1060.0 | Domain | Note=Ig-like C2-type 2 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 697_783 | 67 | 1060.0 | Domain | Note=Ig-like C2-type 3 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 122_142 | 127 | 1120.0 | Repeat | Note=LRR 3 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 146_167 | 127 | 1120.0 | Repeat | Note=LRR 4 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 168_189 | 127 | 1120.0 | Repeat | Note=LRR 5 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 193_214 | 127 | 1120.0 | Repeat | Note=LRR 6 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 216_237 | 127 | 1120.0 | Repeat | Note=LRR 7 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 240_261 | 127 | 1120.0 | Repeat | Note=LRR 8 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 264_285 | 127 | 1120.0 | Repeat | Note=LRR 9 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 288_309 | 127 | 1120.0 | Repeat | Note=LRR 10 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 312_333 | 127 | 1120.0 | Repeat | Note=LRR 11 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 336_357 | 127 | 1120.0 | Repeat | Note=LRR 12 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 360_382 | 127 | 1120.0 | Repeat | Note=LRR 13 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 387_408 | 127 | 1120.0 | Repeat | Note=LRR 14 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 411_432 | 127 | 1120.0 | Repeat | Note=LRR 15 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 122_142 | 67 | 1060.0 | Repeat | Note=LRR 3 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 146_167 | 67 | 1060.0 | Repeat | Note=LRR 4 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 168_189 | 67 | 1060.0 | Repeat | Note=LRR 5 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 193_214 | 67 | 1060.0 | Repeat | Note=LRR 6 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 216_237 | 67 | 1060.0 | Repeat | Note=LRR 7 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 240_261 | 67 | 1060.0 | Repeat | Note=LRR 8 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 264_285 | 67 | 1060.0 | Repeat | Note=LRR 9 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 288_309 | 67 | 1060.0 | Repeat | Note=LRR 10 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 312_333 | 67 | 1060.0 | Repeat | Note=LRR 11 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 336_357 | 67 | 1060.0 | Repeat | Note=LRR 12 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 360_382 | 67 | 1060.0 | Repeat | Note=LRR 13 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 387_408 | 67 | 1060.0 | Repeat | Note=LRR 14 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 411_432 | 67 | 1060.0 | Repeat | Note=LRR 15 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 75_96 | 67 | 1060.0 | Repeat | Note=LRR 1 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 99_120 | 67 | 1060.0 | Repeat | Note=LRR 2 |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000320743 | - | 3 | 19 | 810_830 | 127 | 1120.0 | Transmembrane | Helical |
| Hgene | LRIG3 | chr12:59307763 | chr12:58002860 | ENST00000379141 | - | 3 | 19 | 810_830 | 67 | 1060.0 | Transmembrane | Helical |
| Tgene | DTX3 | chr12:59307763 | chr12:58002860 | ENST00000337737 | 5 | 7 | 122_151 | 322 | 348.0 | Compositional bias | Note=Pro-rich | |
| Tgene | DTX3 | chr12:59307763 | chr12:58002860 | ENST00000548198 | 3 | 5 | 122_151 | 322 | 348.0 | Compositional bias | Note=Pro-rich | |
| Tgene | DTX3 | chr12:59307763 | chr12:58002860 | ENST00000548804 | 4 | 6 | 122_151 | 322 | 348.0 | Compositional bias | Note=Pro-rich | |
| Tgene | DTX3 | chr12:59307763 | chr12:58002860 | ENST00000551632 | 4 | 6 | 122_151 | 325 | 351.0 | Compositional bias | Note=Pro-rich | |
| Tgene | DTX3 | chr12:59307763 | chr12:58002860 | ENST00000337737 | 5 | 7 | 164_205 | 322 | 348.0 | Zinc finger | RING-type | |
| Tgene | DTX3 | chr12:59307763 | chr12:58002860 | ENST00000548198 | 3 | 5 | 164_205 | 322 | 348.0 | Zinc finger | RING-type | |
| Tgene | DTX3 | chr12:59307763 | chr12:58002860 | ENST00000548804 | 4 | 6 | 164_205 | 322 | 348.0 | Zinc finger | RING-type | |
| Tgene | DTX3 | chr12:59307763 | chr12:58002860 | ENST00000551632 | 4 | 6 | 164_205 | 325 | 351.0 | Zinc finger | RING-type |
Top |
Fusion Gene Sequence for LRIG3-DTX3 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >49694_49694_1_LRIG3-DTX3_LRIG3_chr12_59307763_ENST00000320743_DTX3_chr12_58002860_ENST00000551632_length(transcript)=1398nt_BP=670nt GGCGAAAAAGTTTCTTTTGCAGACAAGAAGGGGCTTCGGCGAGCCGACGCTGCTCAAGCTGCAACTCTGTTGCAGTTGGCAGTTCTTTTC GGTTTCCCTCCTGCTGTTTGGGGGCATGAAAGGGCTTCGCCGCCGGGAGTAAAAGAAGGAATTGACCGGGCAGCGCGAGGGAGGAGCGCG CACGCGACCGCGAGGGCGGGCGTGCACCCTCGGCTGGAAGTTTGTGCCGGGCCCCGAGCGCGCGCCGGCTGGGAGCTTCGGGTAGAGACC TAGGCCGCTGGACCGCGATGAGCGCGCCGAGCCTCCGTGCGCGCGCCGCGGGGTTGGGGCTGCTGCTGTGCGCGGTGCTGGGGCGCGCTG GCCGGTCAGACAGCGGCGGTCGCGGGGAACTCGGGCAGCCCTCTGGGGTAGCCGCCGAGCGCCCATGCCCCACTACCTGCCGCTGCCTCG GGGACCTGCTGGACTGCAGTCGTAAGCGGCTAGCGCGTCTTCCCGAGCCACTCCCGTCCTGGGTCGCTCGGCTGGACTTAAGTCACAACA GATTATCTTTCATCAAGGCAAGTTCCATGAGCCACCTTCAAAGCCTTCGAGAAGTGAAACTGAACAACAATGAATTGGAGACCATTCCAA ATCTGGGACCAGTCTCGGCAAATATTACACTTCTCTCCTTGTTTGGGTACCCAGACCCCACCTACCTGACCCGGGTGCAAGAGGAGCTGA GAGCGAAGGGTATCACAGATGACTGAAGGACATCGCCTTTGCCAAGGCCCCTGCTGTCTGCCTCTACTAGGACCCAGCAGAAGCCTCTTT CTCCTCTCTGCCCCCTGCCCCCCACACCACACCTGTAGGGGACCTGTCTGACTGGGAAGGGAGTTCCGAGAGGGAGGGGGCAATCCCTTC CCCCATCCCCCACTGGCCAAGTGTTTCAATGCAGTGTGAGCCACTCCCTTCTGGCAGAGGCCGACCTCCAAGGCTCTGTTCTCCCCTCCC CGTGTACATATACTCCCGGTTTCCCTGCCCCTCCATTGCCCTTGGCTTTTTCTGGTATGTGCTGTGCTCCACGACCAAGCCGAGAAAGGA CCTAGGGTGGGGAAGGGAGGGTCTCTTGATTCCTAACCGCCCCCACATACTGCTCCACCGCTGAACTTCGGGTGCCGGGGAGGAGAAATT GGGCTGATGTGAGCTCCCCGTCACCCGCCATGGAGCCGGCTGTGTGTGTTCATCAGATACAGTTCTCCCTTAACCTTGTCCTTTCTCTCC TGTGTCTCAGTCTCCGTCAGTCTGTCTTTCTCCGCTCTTCTCTGACCCCTGTGAGGAACCTCCTTACCCTGTTCTGGAATCGCTGCCAGA >49694_49694_1_LRIG3-DTX3_LRIG3_chr12_59307763_ENST00000320743_DTX3_chr12_58002860_ENST00000551632_length(amino acids)=174AA_BP=150 MCRAPSARRLGASGRDLGRWTAMSAPSLRARAAGLGLLLCAVLGRAGRSDSGGRGELGQPSGVAAERPCPTTCRCLGDLLDCSRKRLARL -------------------------------------------------------------- >49694_49694_2_LRIG3-DTX3_LRIG3_chr12_59307763_ENST00000379141_DTX3_chr12_58002860_ENST00000551632_length(transcript)=995nt_BP=267nt GTAACTGAAGTCAGGCTTTTCATTTGGGAAGCCCCCTCAACAGAATTCGGTCATTCTCCAAGTTATGGTGGACGTACTTCTGTTGTTCTC CCTCTGCTTGCTTTTTCACATTAGCAGACCGGACTTAAGTCACAACAGATTATCTTTCATCAAGGCAAGTTCCATGAGCCACCTTCAAAG CCTTCGAGAAGTGAAACTGAACAACAATGAATTGGAGACCATTCCAAATCTGGGACCAGTCTCGGCAAATATTACACTTCTCTCCTTGTT TGGGTACCCAGACCCCACCTACCTGACCCGGGTGCAAGAGGAGCTGAGAGCGAAGGGTATCACAGATGACTGAAGGACATCGCCTTTGCC AAGGCCCCTGCTGTCTGCCTCTACTAGGACCCAGCAGAAGCCTCTTTCTCCTCTCTGCCCCCTGCCCCCCACACCACACCTGTAGGGGAC CTGTCTGACTGGGAAGGGAGTTCCGAGAGGGAGGGGGCAATCCCTTCCCCCATCCCCCACTGGCCAAGTGTTTCAATGCAGTGTGAGCCA CTCCCTTCTGGCAGAGGCCGACCTCCAAGGCTCTGTTCTCCCCTCCCCGTGTACATATACTCCCGGTTTCCCTGCCCCTCCATTGCCCTT GGCTTTTTCTGGTATGTGCTGTGCTCCACGACCAAGCCGAGAAAGGACCTAGGGTGGGGAAGGGAGGGTCTCTTGATTCCTAACCGCCCC CACATACTGCTCCACCGCTGAACTTCGGGTGCCGGGGAGGAGAAATTGGGCTGATGTGAGCTCCCCGTCACCCGCCATGGAGCCGGCTGT GTGTGTTCATCAGATACAGTTCTCCCTTAACCTTGTCCTTTCTCTCCTGTGTCTCAGTCTCCGTCAGTCTGTCTTTCTCCGCTCTTCTCT GACCCCTGTGAGGAACCTCCTTACCCTGTTCTGGAATCGCTGCCAGACTGTAGCTTTTAATTTAATAAAAATAAAGTAAAATATGCAACT >49694_49694_2_LRIG3-DTX3_LRIG3_chr12_59307763_ENST00000379141_DTX3_chr12_58002860_ENST00000551632_length(amino acids)=142AA_BP=1 MEVGLCQKGVAHTALKHLASGGWGKGLPPPSRNSLPSQTGPLQVWCGGQGAERRKRLLLGPSRGRQQGPWQRRCPSVICDTLRSQLLLHP -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for LRIG3-DTX3 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for LRIG3-DTX3 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for LRIG3-DTX3 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies