|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:MAP3K2-IWS1 (FusionGDB2 ID:51293) |
Fusion Gene Summary for MAP3K2-IWS1 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: MAP3K2-IWS1 | Fusion gene ID: 51293 | Hgene | Tgene | Gene symbol | MAP3K2 | IWS1 | Gene ID | 10746 | 55677 |
| Gene name | mitogen-activated protein kinase kinase kinase 2 | interacts with SUPT6H, CTD assembly factor 1 | |
| Synonyms | MEKK2|MEKK2B | - | |
| Cytomap | 2q14.3 | 2q14.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | mitogen-activated protein kinase kinase kinase 2MAP/ERK kinase kinase 2MAPK/ERK kinase kinase 2MEK kinase 2MEKK 2 | protein IWS1 homologIWS1 homologIWS1, SUPT6H interacting proteinIWS1-like proteininteracts with Spt6 | |
| Modification date | 20200329 | 20200313 | |
| UniProtAcc | Q9Y2U5 | Q96ST2 | |
| Ensembl transtripts involved in fusion gene | ENST00000344908, ENST00000409947, | ENST00000455721, ENST00000486662, ENST00000295321, | |
| Fusion gene scores | * DoF score | 10 X 8 X 3=240 | 3 X 4 X 2=24 |
| # samples | 9 | 4 | |
| ** MAII score | log2(9/240*10)=-1.41503749927884 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/24*10)=0.736965594166206 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
| Context | PubMed: MAP3K2 [Title/Abstract] AND IWS1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | MAP3K2(128093446)-IWS1(128238751), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | MAP3K2-IWS1 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. MAP3K2-IWS1 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. MAP3K2-IWS1 seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. MAP3K2-IWS1 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | MAP3K2 | GO:0045893 | positive regulation of transcription, DNA-templated | 14515274 |
| Fusion gene breakpoints across MAP3K2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across IWS1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BRCA | TCGA-AC-A2BM-01A | MAP3K2 | chr2 | 128093446 | - | IWS1 | chr2 | 128238751 | - |
Top |
Fusion Gene ORF analysis for MAP3K2-IWS1 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| 5CDS-intron | ENST00000344908 | ENST00000455721 | MAP3K2 | chr2 | 128093446 | - | IWS1 | chr2 | 128238751 | - |
| 5CDS-intron | ENST00000344908 | ENST00000486662 | MAP3K2 | chr2 | 128093446 | - | IWS1 | chr2 | 128238751 | - |
| 5CDS-intron | ENST00000409947 | ENST00000455721 | MAP3K2 | chr2 | 128093446 | - | IWS1 | chr2 | 128238751 | - |
| 5CDS-intron | ENST00000409947 | ENST00000486662 | MAP3K2 | chr2 | 128093446 | - | IWS1 | chr2 | 128238751 | - |
| Frame-shift | ENST00000344908 | ENST00000295321 | MAP3K2 | chr2 | 128093446 | - | IWS1 | chr2 | 128238751 | - |
| In-frame | ENST00000409947 | ENST00000295321 | MAP3K2 | chr2 | 128093446 | - | IWS1 | chr2 | 128238751 | - |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000409947 | MAP3K2 | chr2 | 128093446 | - | ENST00000295321 | IWS1 | chr2 | 128238751 | - | 917 | 547 | 271 | 678 | 135 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000409947 | ENST00000295321 | MAP3K2 | chr2 | 128093446 | - | IWS1 | chr2 | 128238751 | - | 0.008261735 | 0.99173826 |
Top |
Fusion Genomic Features for MAP3K2-IWS1 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for MAP3K2-IWS1 |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:128093446/chr2:128238751) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| MAP3K2 | IWS1 |
| FUNCTION: Component of a protein kinase signal transduction cascade. Regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7 (By similarity). Plays a role in caveolae kiss-and-run dynamics. {ECO:0000250, ECO:0000269|PubMed:10713157, ECO:0000269|PubMed:16001074}. | FUNCTION: Transcription factor which plays a key role in defining the composition of the RNA polymerase II (RNAPII) elongation complex and in modulating the production of mature mRNA transcripts. Acts as an assembly factor to recruit various factors to the RNAPII elongation complex and is recruited to the complex via binding to the transcription elongation factor SUPT6H bound to the C-terminal domain (CTD) of the RNAPII subunit RPB1 (POLR2A). The SUPT6H:IWS1:CTD complex recruits mRNA export factors (ALYREF/THOC4, EXOSC10) as well as histone modifying enzymes (such as SETD2) to ensure proper mRNA splicing, efficient mRNA export and elongation-coupled H3K36 methylation, a signature chromatin mark of active transcription. {ECO:0000269|PubMed:17184735, ECO:0000269|PubMed:17234882, ECO:0000269|PubMed:19141475}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MAP3K2 | chr2:128093446 | chr2:128238751 | ENST00000344908 | - | 4 | 16 | 357_617 | 88 | 620.0 | Domain | Protein kinase |
| Hgene | MAP3K2 | chr2:128093446 | chr2:128238751 | ENST00000344908 | - | 4 | 16 | 43_122 | 88 | 620.0 | Domain | PB1 |
| Hgene | MAP3K2 | chr2:128093446 | chr2:128238751 | ENST00000409947 | - | 5 | 17 | 357_617 | 88 | 620.0 | Domain | Protein kinase |
| Hgene | MAP3K2 | chr2:128093446 | chr2:128238751 | ENST00000409947 | - | 5 | 17 | 43_122 | 88 | 620.0 | Domain | PB1 |
| Hgene | MAP3K2 | chr2:128093446 | chr2:128238751 | ENST00000344908 | - | 4 | 16 | 362_371 | 88 | 620.0 | Nucleotide binding | ATP |
| Hgene | MAP3K2 | chr2:128093446 | chr2:128238751 | ENST00000409947 | - | 5 | 17 | 362_371 | 88 | 620.0 | Nucleotide binding | ATP |
| Tgene | IWS1 | chr2:128093446 | chr2:128238751 | ENST00000295321 | 12 | 14 | 83_509 | 776 | 820.0 | Compositional bias | Note=Glu-rich | |
| Tgene | IWS1 | chr2:128093446 | chr2:128238751 | ENST00000295321 | 12 | 14 | 614_692 | 776 | 820.0 | Domain | TFIIS N-terminal | |
| Tgene | IWS1 | chr2:128093446 | chr2:128238751 | ENST00000295321 | 12 | 14 | 469_495 | 776 | 820.0 | Motif | Integrase domain-binding motif (IBM) | |
| Tgene | IWS1 | chr2:128093446 | chr2:128238751 | ENST00000295321 | 12 | 14 | 235_296 | 776 | 820.0 | Region | Note=3 X approximate tandem repeats | |
| Tgene | IWS1 | chr2:128093446 | chr2:128238751 | ENST00000295321 | 12 | 14 | 235_260 | 776 | 820.0 | Repeat | Note=1 | |
| Tgene | IWS1 | chr2:128093446 | chr2:128238751 | ENST00000295321 | 12 | 14 | 261_286 | 776 | 820.0 | Repeat | Note=2 | |
| Tgene | IWS1 | chr2:128093446 | chr2:128238751 | ENST00000295321 | 12 | 14 | 287_296 | 776 | 820.0 | Repeat | Note=3%3B half-length |
Top |
Fusion Gene Sequence for MAP3K2-IWS1 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >51293_51293_1_MAP3K2-IWS1_MAP3K2_chr2_128093446_ENST00000409947_IWS1_chr2_128238751_ENST00000295321_length(transcript)=917nt_BP=547nt TTTCTAAAGTCCCTCAGGAAAAAAATTCTGAAACTTGAGCCACAAATTAAGAGGCAGACGGCTTTTCTCCTTGCAAATGACCTGCCACAC AGTCCGTCACTGCCTCTGCTAGCTCTGCTACCCTTGGGCCCTGTCCACAGCCCACGTGGGAGACCTTTTCACGGGATCTACTCGGATGTC TGGGATCTGGCCACTACCGCAGGCTCGAGACAACCCAGGCCATAAAGAATGCTGATGGGAGAACCATTTTCCTAATTTTCAAATTGTTGA GCTGTTTGCCATAATGGATGATCAGCAAGCTTTGAACTCAATCATGCAAGATTTGGCTGTCCTTCATAAGGCCAGTCGACCAGCATTATC CTTGCAGGAAACCAGAAAAGCAAAATCTTCATCACCAAAAAAACAGAATGATGTCCGAGTCAAATTTGAACATAGAGGAGAAAAAAGAAT CCTTCAGTTCCCCAGACCAGTTAAACTGGAAGATCTGAGATCTAAAGCTAAAATTGCCTTTGGACAGTCTATGGATCTACATTATACCAA TAACGAGTTTCAGGCGACCTCCAAGAAGGGTATCAGTCGACTGGATAAACAGATGAGAAAGTTCACAGATATAAGGAAAAAAAGCAGATC TGCACACGCAGTGAAAATCAGCATTGAGGGCAACAAAATGCCATTGTGACCTTGCCTGGAATGTGTCCCCATCTCTACTCTAAGAAATGC GCAATGGACTCTTTGGAGAAAGAAGATATTTTAAAACATTTTTAGTGTGTCTGTAAATGGTTCAGCGTGTATCAGATGTTGTCATAGGAC TCACATTTCTCTCAGTTATATTTAAAACCGTTGTGTACTTTGTACAAAGGAATACTAGTCATACTTCTATAAACTTTACACAATAAAATT >51293_51293_1_MAP3K2-IWS1_MAP3K2_chr2_128093446_ENST00000409947_IWS1_chr2_128238751_ENST00000295321_length(amino acids)=135AA_BP=92 MFAIMDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTN -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for MAP3K2-IWS1 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Tgene | IWS1 | chr2:128093446 | chr2:128238751 | ENST00000295321 | 12 | 14 | 523_819 | 776.0 | 820.0 | SUPT6H and ALYREF |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for MAP3K2-IWS1 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for MAP3K2-IWS1 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies