|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:MCU-CHCHD1 (FusionGDB2 ID:52321) |
Fusion Gene Summary for MCU-CHCHD1 |
Fusion gene summary |
Fusion gene information | Fusion gene name: MCU-CHCHD1 | Fusion gene ID: 52321 | Hgene | Tgene | Gene symbol | MCU | CHCHD1 | Gene ID | 90550 | 118487 |
Gene name | mitochondrial calcium uniporter | coiled-coil-helix-coiled-coil-helix domain containing 1 | |
Synonyms | C10orf42|CCDC109A|HsMCU | C10orf34|C2360|MRP-S37 | |
Cytomap | 10q22.1 | 10q22.2 | |
Type of gene | protein-coding | protein-coding | |
Description | calcium uniporter protein, mitochondrialcoiled-coil domain-containing protein 109A | coiled-coil-helix-coiled-coil-helix domain-containing protein 128S ribosomal protein S37, mitochondrialmitochondrial small ribosomal subunit protein mS37nuclear protein C2360 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q8NE86 | Q8WYQ3 | |
Ensembl transtripts involved in fusion gene | ENST00000357157, ENST00000373053, ENST00000536019, ENST00000605416, | ENST00000372833, ENST00000372837, | |
Fusion gene scores | * DoF score | 9 X 6 X 4=216 | 1 X 2 X 1=2 |
# samples | 10 | 1 | |
** MAII score | log2(10/216*10)=-1.11103131238874 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(1/2*10)=2.32192809488736 | |
Context | PubMed: MCU [Title/Abstract] AND CHCHD1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | MCU(74594186)-CHCHD1(75542832), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | MCU-CHCHD1 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. MCU-CHCHD1 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | MCU | GO:0006851 | mitochondrial calcium ion transmembrane transport | 21685888|24560927 |
Hgene | MCU | GO:0019722 | calcium-mediated signaling | 21685886|21685888 |
Hgene | MCU | GO:0036444 | calcium import into the mitochondrion | 22925203 |
Hgene | MCU | GO:0051259 | protein complex oligomerization | 21685886 |
Hgene | MCU | GO:0051561 | positive regulation of mitochondrial calcium ion concentration | 21685888|24560927 |
Fusion gene breakpoints across MCU (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across CHCHD1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-AR-A24L-01A | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542081 | + |
ChimerDB4 | BRCA | TCGA-AR-A24L-01A | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542832 | + |
Top |
Fusion Gene ORF analysis for MCU-CHCHD1 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-3UTR | ENST00000357157 | ENST00000372833 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542832 | + |
5CDS-3UTR | ENST00000357157 | ENST00000372837 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542832 | + |
5CDS-3UTR | ENST00000373053 | ENST00000372833 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542832 | + |
5CDS-3UTR | ENST00000373053 | ENST00000372837 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542832 | + |
5CDS-3UTR | ENST00000536019 | ENST00000372833 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542832 | + |
5CDS-3UTR | ENST00000536019 | ENST00000372837 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542832 | + |
Frame-shift | ENST00000357157 | ENST00000372837 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542081 | + |
Frame-shift | ENST00000373053 | ENST00000372837 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542081 | + |
Frame-shift | ENST00000536019 | ENST00000372837 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542081 | + |
In-frame | ENST00000357157 | ENST00000372833 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542081 | + |
In-frame | ENST00000373053 | ENST00000372833 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542081 | + |
In-frame | ENST00000536019 | ENST00000372833 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542081 | + |
intron-3CDS | ENST00000605416 | ENST00000372833 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542081 | + |
intron-3CDS | ENST00000605416 | ENST00000372837 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542081 | + |
intron-3UTR | ENST00000605416 | ENST00000372833 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542832 | + |
intron-3UTR | ENST00000605416 | ENST00000372837 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542832 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000373053 | MCU | chr10 | 74594186 | + | ENST00000372833 | CHCHD1 | chr10 | 75542081 | + | 939 | 241 | 21 | 473 | 150 |
ENST00000357157 | MCU | chr10 | 74594186 | + | ENST00000372833 | CHCHD1 | chr10 | 75542081 | + | 927 | 229 | 9 | 461 | 150 |
ENST00000536019 | MCU | chr10 | 74594186 | + | ENST00000372833 | CHCHD1 | chr10 | 75542081 | + | 1216 | 518 | 17 | 406 | 129 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000373053 | ENST00000372833 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542081 | + | 0.07727054 | 0.92272943 |
ENST00000357157 | ENST00000372833 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542081 | + | 0.1019829 | 0.89801717 |
ENST00000536019 | ENST00000372833 | MCU | chr10 | 74594186 | + | CHCHD1 | chr10 | 75542081 | + | 0.08047338 | 0.91952664 |
Top |
Fusion Genomic Features for MCU-CHCHD1 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for MCU-CHCHD1 |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr10:74594186/chr10:75542832) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
MCU | CHCHD1 |
FUNCTION: Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria (PubMed:21685888, PubMed:21685886, PubMed:23101630, PubMed:22904319, PubMed:23178883, PubMed:22829870, PubMed:22822213, PubMed:24332854, PubMed:23755363, PubMed:26341627). Constitutes the pore-forming and calcium-conducting subunit of the uniporter complex (uniplex) (PubMed:23755363). Activity is regulated by MICU1 and MICU2. At low Ca(2+) levels MCU activity is down-regulated by MICU1 and MICU2; at higher Ca(2+) levels MICU1 increases MCU activity (PubMed:24560927, PubMed:26903221). Mitochondrial calcium homeostasis plays key roles in cellular physiology and regulates cell bioenergetics, cytoplasmic calcium signals and activation of cell death pathways. Involved in buffering the amplitude of systolic calcium rises in cardiomyocytes (PubMed:22822213). While dispensable for baseline homeostatic cardiac function, acts as a key regulator of short-term mitochondrial calcium loading underlying a 'fight-or-flight' response during acute stress: acts by mediating a rapid increase of mitochondrial calcium in pacemaker cells (PubMed:25603276). participates in mitochondrial permeability transition during ischemia-reperfusion injury (By similarity). Regulates glucose-dependent insulin secretion in pancreatic beta-cells by regulating mitochondrial calcium uptake (PubMed:22904319, PubMed:22829870). Mitochondrial calcium uptake in skeletal muscle cells is involved in muscle size in adults (By similarity). Regulates synaptic vesicle endocytosis kinetics in central nerve terminal (By similarity). Involved in antigen processing and presentation (By similarity). {ECO:0000250|UniProtKB:Q3UMR5, ECO:0000269|PubMed:21685886, ECO:0000269|PubMed:21685888, ECO:0000269|PubMed:22822213, ECO:0000269|PubMed:22829870, ECO:0000269|PubMed:22904319, ECO:0000269|PubMed:23101630, ECO:0000269|PubMed:23178883, ECO:0000269|PubMed:23755363, ECO:0000269|PubMed:24332854, ECO:0000269|PubMed:24560927, ECO:0000269|PubMed:25603276, ECO:0000269|PubMed:26341627, ECO:0000269|PubMed:26903221}. | FUNCTION: May be involved in the maintenance of mitochondrial organization and mitochondrial cristae structure. {ECO:0000269|PubMed:24934289}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | CHCHD1 | chr10:74594186 | chr10:75542081 | ENST00000372833 | 0 | 3 | 42_84 | 41 | 119.0 | Domain | CHCH | |
Tgene | CHCHD1 | chr10:74594186 | chr10:75542081 | ENST00000372833 | 0 | 3 | 45_55 | 41 | 119.0 | Motif | Cx9C motif 1 | |
Tgene | CHCHD1 | chr10:74594186 | chr10:75542081 | ENST00000372833 | 0 | 3 | 66_76 | 41 | 119.0 | Motif | Cx9C motif 2 |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000357157 | + | 2 | 8 | 192_223 | 73 | 331.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000357157 | + | 2 | 8 | 311_339 | 73 | 331.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000373053 | + | 2 | 8 | 192_223 | 73 | 352.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000373053 | + | 2 | 8 | 311_339 | 73 | 352.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000536019 | + | 2 | 8 | 192_223 | 24 | 303.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000536019 | + | 2 | 8 | 311_339 | 24 | 303.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000357157 | + | 2 | 8 | 216_234 | 73 | 331.0 | Region | Outer juxtamembrane helix (OJMH) |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000357157 | + | 2 | 8 | 283_292 | 73 | 331.0 | Region | Inner juxtamembrane helix (IJMH) |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000357157 | + | 2 | 8 | 75_165 | 73 | 331.0 | Region | N-terminal MCU domain |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000373053 | + | 2 | 8 | 216_234 | 73 | 352.0 | Region | Outer juxtamembrane helix (OJMH) |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000373053 | + | 2 | 8 | 283_292 | 73 | 352.0 | Region | Inner juxtamembrane helix (IJMH) |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000373053 | + | 2 | 8 | 75_165 | 73 | 352.0 | Region | N-terminal MCU domain |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000536019 | + | 2 | 8 | 216_234 | 24 | 303.0 | Region | Outer juxtamembrane helix (OJMH) |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000536019 | + | 2 | 8 | 283_292 | 24 | 303.0 | Region | Inner juxtamembrane helix (IJMH) |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000536019 | + | 2 | 8 | 75_165 | 24 | 303.0 | Region | N-terminal MCU domain |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000357157 | + | 2 | 8 | 257_265 | 73 | 331.0 | Topological domain | Mitochondrial intermembrane |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000357157 | + | 2 | 8 | 284_351 | 73 | 331.0 | Topological domain | Mitochondrial matrix |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000357157 | + | 2 | 8 | 51_233 | 73 | 331.0 | Topological domain | Mitochondrial matrix |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000373053 | + | 2 | 8 | 257_265 | 73 | 352.0 | Topological domain | Mitochondrial intermembrane |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000373053 | + | 2 | 8 | 284_351 | 73 | 352.0 | Topological domain | Mitochondrial matrix |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000373053 | + | 2 | 8 | 51_233 | 73 | 352.0 | Topological domain | Mitochondrial matrix |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000536019 | + | 2 | 8 | 257_265 | 24 | 303.0 | Topological domain | Mitochondrial intermembrane |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000536019 | + | 2 | 8 | 284_351 | 24 | 303.0 | Topological domain | Mitochondrial matrix |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000536019 | + | 2 | 8 | 51_233 | 24 | 303.0 | Topological domain | Mitochondrial matrix |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000357157 | + | 2 | 8 | 234_256 | 73 | 331.0 | Transmembrane | Helical |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000357157 | + | 2 | 8 | 266_283 | 73 | 331.0 | Transmembrane | Helical |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000373053 | + | 2 | 8 | 234_256 | 73 | 352.0 | Transmembrane | Helical |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000373053 | + | 2 | 8 | 266_283 | 73 | 352.0 | Transmembrane | Helical |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000536019 | + | 2 | 8 | 234_256 | 24 | 303.0 | Transmembrane | Helical |
Hgene | MCU | chr10:74594186 | chr10:75542081 | ENST00000536019 | + | 2 | 8 | 266_283 | 24 | 303.0 | Transmembrane | Helical |
Top |
Fusion Gene Sequence for MCU-CHCHD1 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>52321_52321_1_MCU-CHCHD1_MCU_chr10_74594186_ENST00000357157_CHCHD1_chr10_75542081_ENST00000372833_length(transcript)=927nt_BP=229nt AGTTGAGAGATGGCGGCCGCCGCAGGTAGATCGCTCCTGCTGCTCCTCTCCTCTCGGGGCGGCGGCGGCGGGGGCGCCGGCGGCTGCGGG GCGCTGACTGCCGGCTGCTTCCCTGGGCTGGGCGTCAGCCGCCACCGGCAGCAGCAGCACCACCGGACGGTACACCAGAGGATCGCTTCC TGGCAGAATTTGGGAGCTGTTTATTGCAGCACTGTTGTGCCCTCTGATGAGGCGACTTGCATCACGGAGATGTCGGTGATGATGGCTTGC TGGAAGCAGAATGAATTCCGCGACGATGCGTGCAGAAAAGAGATCCAGGGCTTCCTCGATTGTGCCGCGAGGGCTCAGGAAGCCCGAAAG ATGAGATCAATACAGGAAACCCTGGGAGAGTCTGGGAGTTTACTTCCAAATAAATTGAATAAGTTGTTACAGAGGTTTCCTAACAAACCT TACCTCAGCTGAAAATGGACAAGTATTTTCAATGACTGAAATATAGCTTCTGACAACTATGCAGAGGCATTTTAGAGACATTGGCATTGC CATGCCCTCTTTGGAGGGTAGAAGAGGCAAAACACTTTTTTCACCCTTTGGAATCATAGTATGGGTAGAAGTTATGATTTATCTTGAAAT AAAATCCTCTGAACAGAACTTGGCCTTTTGTTGTGAATTAGGTACTCTCTTCATTCTTGAGCCTCCCCTAGACCCTGGAAATTCTTTCCT TCCTGATTTGCCCTAGGAGCAGGACAAATACCGTTGTATTGTCTTTCCCTGCATTTGAAGTCTTTTACACCATTTAGTGCCCTTGCTTTT GGATGCAATAAGGAAGTTGAAGTTGCCTTCGTCTGTAAATACTTAGTGATTGCCTATTTTGTGCGTAGTCCCTGCAAGGTGCTCTCTGAA >52321_52321_1_MCU-CHCHD1_MCU_chr10_74594186_ENST00000357157_CHCHD1_chr10_75542081_ENST00000372833_length(amino acids)=150AA_BP=73 MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVYCSTVVPSDEATCITEMSVMMACWKQ -------------------------------------------------------------- >52321_52321_2_MCU-CHCHD1_MCU_chr10_74594186_ENST00000373053_CHCHD1_chr10_75542081_ENST00000372833_length(transcript)=939nt_BP=241nt GGCGCCGTTTCCAGTTGAGAGATGGCGGCCGCCGCAGGTAGATCGCTCCTGCTGCTCCTCTCCTCTCGGGGCGGCGGCGGCGGGGGCGCC GGCGGCTGCGGGGCGCTGACTGCCGGCTGCTTCCCTGGGCTGGGCGTCAGCCGCCACCGGCAGCAGCAGCACCACCGGACGGTACACCAG AGGATCGCTTCCTGGCAGAATTTGGGAGCTGTTTATTGCAGCACTGTTGTGCCCTCTGATGAGGCGACTTGCATCACGGAGATGTCGGTG ATGATGGCTTGCTGGAAGCAGAATGAATTCCGCGACGATGCGTGCAGAAAAGAGATCCAGGGCTTCCTCGATTGTGCCGCGAGGGCTCAG GAAGCCCGAAAGATGAGATCAATACAGGAAACCCTGGGAGAGTCTGGGAGTTTACTTCCAAATAAATTGAATAAGTTGTTACAGAGGTTT CCTAACAAACCTTACCTCAGCTGAAAATGGACAAGTATTTTCAATGACTGAAATATAGCTTCTGACAACTATGCAGAGGCATTTTAGAGA CATTGGCATTGCCATGCCCTCTTTGGAGGGTAGAAGAGGCAAAACACTTTTTTCACCCTTTGGAATCATAGTATGGGTAGAAGTTATGAT TTATCTTGAAATAAAATCCTCTGAACAGAACTTGGCCTTTTGTTGTGAATTAGGTACTCTCTTCATTCTTGAGCCTCCCCTAGACCCTGG AAATTCTTTCCTTCCTGATTTGCCCTAGGAGCAGGACAAATACCGTTGTATTGTCTTTCCCTGCATTTGAAGTCTTTTACACCATTTAGT GCCCTTGCTTTTGGATGCAATAAGGAAGTTGAAGTTGCCTTCGTCTGTAAATACTTAGTGATTGCCTATTTTGTGCGTAGTCCCTGCAAG >52321_52321_2_MCU-CHCHD1_MCU_chr10_74594186_ENST00000373053_CHCHD1_chr10_75542081_ENST00000372833_length(amino acids)=150AA_BP=73 MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVYCSTVVPSDEATCITEMSVMMACWKQ -------------------------------------------------------------- >52321_52321_3_MCU-CHCHD1_MCU_chr10_74594186_ENST00000536019_CHCHD1_chr10_75542081_ENST00000372833_length(transcript)=1216nt_BP=518nt CTTCGTTCTTAACAGCCCTGCCCCAAGGCTCCCTGAACGGAGCCAGATGGAAGTTGTCCCCTTTCCCTCCTCCTCCGGGCGGGTTGGGGA GTTCTGAGTTGCCGCGGCCGCCTTGTGTGTGCCAGGAGAGTGGCAGTGCCATGCTGCTGGGAGCTGCCCCGGAGAGCAGCCCAGGACCCC GGCGGGGCCGCCCCTCGTCCTCTCTCGTCCCCGAGGGGTCGGGCAGGAAGGAAAATCAAACTTTATTCCCCTCTGTGACTTCCTCTGTGT GTGTGCATGGGGAACCGGCTCCCTCGAGATGGATGCTGCATTGCTTCAGGAGGCAAGCTTCATCCTCTTGGGTCCTTAAAGGTGCTTTTG GGGGTCCTTTCGAGGGCTACTGTATAAGCGTGTTCACGCGTGCCTGAAGCGGGAAGGGTGGTCAGCAGGCACAGGAGAAGCGAATATGGT ACACCAGAGGATCGCTTCCTGGCAGAATTTGGGAGCTGTTTATTGCAGCACTGTTGTGCCCTCTGATGAGGCGACTTGCATCACGGAGAT GTCGGTGATGATGGCTTGCTGGAAGCAGAATGAATTCCGCGACGATGCGTGCAGAAAAGAGATCCAGGGCTTCCTCGATTGTGCCGCGAG GGCTCAGGAAGCCCGAAAGATGAGATCAATACAGGAAACCCTGGGAGAGTCTGGGAGTTTACTTCCAAATAAATTGAATAAGTTGTTACA GAGGTTTCCTAACAAACCTTACCTCAGCTGAAAATGGACAAGTATTTTCAATGACTGAAATATAGCTTCTGACAACTATGCAGAGGCATT TTAGAGACATTGGCATTGCCATGCCCTCTTTGGAGGGTAGAAGAGGCAAAACACTTTTTTCACCCTTTGGAATCATAGTATGGGTAGAAG TTATGATTTATCTTGAAATAAAATCCTCTGAACAGAACTTGGCCTTTTGTTGTGAATTAGGTACTCTCTTCATTCTTGAGCCTCCCCTAG ACCCTGGAAATTCTTTCCTTCCTGATTTGCCCTAGGAGCAGGACAAATACCGTTGTATTGTCTTTCCCTGCATTTGAAGTCTTTTACACC ATTTAGTGCCCTTGCTTTTGGATGCAATAAGGAAGTTGAAGTTGCCTTCGTCTGTAAATACTTAGTGATTGCCTATTTTGTGCGTAGTCC >52321_52321_3_MCU-CHCHD1_MCU_chr10_74594186_ENST00000536019_CHCHD1_chr10_75542081_ENST00000372833_length(amino acids)=129AA_BP= MPQGSLNGARWKLSPFPPPPGGLGSSELPRPPCVCQESGSAMLLGAAPESSPGPRRGRPSSSLVPEGSGRKENQTLFPSVTSSVCVHGEP -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for MCU-CHCHD1 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for MCU-CHCHD1 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for MCU-CHCHD1 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |