|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:MVP-CHGA (FusionGDB2 ID:56102) |
Fusion Gene Summary for MVP-CHGA |
Fusion gene summary |
Fusion gene information | Fusion gene name: MVP-CHGA | Fusion gene ID: 56102 | Hgene | Tgene | Gene symbol | MVP | CHGA | Gene ID | 9961 | 1113 |
Gene name | major vault protein | chromogranin A | |
Synonyms | LRP|VAULT1 | CGA | |
Cytomap | 16p11.2 | 14q32.12 | |
Type of gene | protein-coding | protein-coding | |
Description | major vault proteinlung resistance-related proteintesticular secretory protein Li 30 | chromogranin-ASP-Ibetagranin (N-terminal fragment of chromogranin A)catestatinchromofunginparathyroid secretory protein 1pituitary secretory protein I | |
Modification date | 20200313 | 20200315 | |
UniProtAcc | Q14764 | P10645 | |
Ensembl transtripts involved in fusion gene | ENST00000357402, ENST00000395353, ENST00000452209, ENST00000566554, | ENST00000553866, ENST00000216492, ENST00000334654, | |
Fusion gene scores | * DoF score | 9 X 10 X 6=540 | 14 X 26 X 3=1092 |
# samples | 13 | 19 | |
** MAII score | log2(13/540*10)=-2.05444778402238 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(19/1092*10)=-2.5229015325889 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: MVP [Title/Abstract] AND CHGA [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | MVP(29848279)-CHGA(93398715), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | MVP | GO:0023057 | negative regulation of signaling | 16441665 |
Hgene | MVP | GO:0031953 | negative regulation of protein autophosphorylation | 16441665 |
Hgene | MVP | GO:0038127 | ERBB signaling pathway | 15133037 |
Hgene | MVP | GO:0061099 | negative regulation of protein tyrosine kinase activity | 16441665 |
Tgene | CHGA | GO:0002551 | mast cell chemotaxis | 21214543 |
Tgene | CHGA | GO:0032762 | mast cell cytokine production | 21214543 |
Tgene | CHGA | GO:0033604 | negative regulation of catecholamine secretion | 15326220 |
Tgene | CHGA | GO:0043303 | mast cell degranulation | 21214543 |
Tgene | CHGA | GO:0045576 | mast cell activation | 21214543 |
Tgene | CHGA | GO:0050829 | defense response to Gram-negative bacterium | 15723172 |
Tgene | CHGA | GO:0050830 | defense response to Gram-positive bacterium | 15723172 |
Fusion gene breakpoints across MVP (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across CHGA (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | PCPG | TCGA-P7-A5NY-01A | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
Top |
Fusion Gene ORF analysis for MVP-CHGA |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000357402 | ENST00000553866 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
5CDS-intron | ENST00000395353 | ENST00000553866 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
5CDS-intron | ENST00000452209 | ENST00000553866 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
Frame-shift | ENST00000357402 | ENST00000216492 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
Frame-shift | ENST00000357402 | ENST00000334654 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
Frame-shift | ENST00000395353 | ENST00000216492 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
Frame-shift | ENST00000395353 | ENST00000334654 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
In-frame | ENST00000452209 | ENST00000216492 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
In-frame | ENST00000452209 | ENST00000334654 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
intron-3CDS | ENST00000566554 | ENST00000216492 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
intron-3CDS | ENST00000566554 | ENST00000334654 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
intron-intron | ENST00000566554 | ENST00000553866 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000452209 | MVP | chr16 | 29848279 | + | ENST00000216492 | CHGA | chr14 | 93398715 | + | 1470 | 495 | 101 | 1060 | 319 |
ENST00000452209 | MVP | chr16 | 29848279 | + | ENST00000334654 | CHGA | chr14 | 93398715 | + | 1430 | 495 | 101 | 1060 | 319 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000452209 | ENST00000216492 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + | 0.26853272 | 0.7314673 |
ENST00000452209 | ENST00000334654 | MVP | chr16 | 29848279 | + | CHGA | chr14 | 93398715 | + | 0.23324597 | 0.76675403 |
Top |
Fusion Genomic Features for MVP-CHGA |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for MVP-CHGA |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr16:29848279/chr14:93398715) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
MVP | CHGA |
FUNCTION: Required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. Down-regulates IFNG-mediated STAT1 signaling and subsequent activation of JAK. Down-regulates SRC activity and signaling through MAP kinases. {ECO:0000269|PubMed:15133037, ECO:0000269|PubMed:16418217, ECO:0000269|PubMed:16441665}. | FUNCTION: [Pancreastatin]: Strongly inhibits glucose induced insulin release from the pancreas.; FUNCTION: [Catestatin]: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist (PubMed:15326220). Displays antibacterial activity against Gram-positive bacteria S.aureus and M.luteus, and Gram-negative bacteria E.coli and P.aeruginosa (PubMed:15723172 and PubMed:24723458). Can induce mast cell migration, degranulation and production of cytokines and chemokines (PubMed:21214543). Acts as a potent scavenger of free radicals in vitro (PubMed:24723458). May play a role in the regulation of cardiac function and blood pressure (PubMed:18541522). {ECO:0000269|PubMed:15326220, ECO:0000269|PubMed:15723172, ECO:0000269|PubMed:21214543, ECO:0000269|PubMed:24723458, ECO:0000303|PubMed:18541522}.; FUNCTION: [Serpinin]: Regulates granule biogenesis in endocrine cells by up-regulating the transcription of protease nexin 1 (SERPINE2) via a cAMP-PKA-SP1 pathway. This leads to inhibition of granule protein degradation in the Golgi complex which in turn promotes granule formation. {ECO:0000250|UniProtKB:P26339}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000357402 | + | 7 | 15 | 112_164 | 303 | 894.0 | Repeat | Note=MVP 3 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000357402 | + | 7 | 15 | 165_217 | 303 | 894.0 | Repeat | Note=MVP 4 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000357402 | + | 7 | 15 | 218_272 | 303 | 894.0 | Repeat | Note=MVP 5 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000357402 | + | 7 | 15 | 2_56 | 303 | 894.0 | Repeat | Note=MVP 1 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000357402 | + | 7 | 15 | 57_111 | 303 | 894.0 | Repeat | Note=MVP 2 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000395353 | + | 7 | 15 | 112_164 | 303 | 894.0 | Repeat | Note=MVP 3 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000395353 | + | 7 | 15 | 165_217 | 303 | 894.0 | Repeat | Note=MVP 4 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000395353 | + | 7 | 15 | 218_272 | 303 | 894.0 | Repeat | Note=MVP 5 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000395353 | + | 7 | 15 | 2_56 | 303 | 894.0 | Repeat | Note=MVP 1 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000395353 | + | 7 | 15 | 57_111 | 303 | 894.0 | Repeat | Note=MVP 2 |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000357402 | + | 7 | 15 | 273_323 | 303 | 894.0 | Repeat | Note=MVP 6 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000357402 | + | 7 | 15 | 324_379 | 303 | 894.0 | Repeat | Note=MVP 7 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000357402 | + | 7 | 15 | 380_457 | 303 | 894.0 | Repeat | Note=MVP 8 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000357402 | + | 7 | 15 | 458_520 | 303 | 894.0 | Repeat | Note=MVP 9 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000395353 | + | 7 | 15 | 273_323 | 303 | 894.0 | Repeat | Note=MVP 6 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000395353 | + | 7 | 15 | 324_379 | 303 | 894.0 | Repeat | Note=MVP 7 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000395353 | + | 7 | 15 | 380_457 | 303 | 894.0 | Repeat | Note=MVP 8 |
Hgene | MVP | chr16:29848279 | chr14:93398715 | ENST00000395353 | + | 7 | 15 | 458_520 | 303 | 894.0 | Repeat | Note=MVP 9 |
Tgene | CHGA | chr16:29848279 | chr14:93398715 | ENST00000216492 | 5 | 8 | 181_191 | 269 | 458.0 | Region | Note=O-glycosylated at one site only in cerebrospinal fluid | |
Tgene | CHGA | chr16:29848279 | chr14:93398715 | ENST00000216492 | 5 | 8 | 41_59 | 269 | 458.0 | Region | Note=O-glycosylated at one site only in cerebrospinal fluid |
Top |
Fusion Gene Sequence for MVP-CHGA |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>56102_56102_1_MVP-CHGA_MVP_chr16_29848279_ENST00000452209_CHGA_chr14_93398715_ENST00000216492_length(transcript)=1470nt_BP=495nt AAGGCAGGGTGAGAGTTCCCCATCTGAGGCGTTTGTTGCAGCTACCTGCACTTCTAGATTCATCTTCTTGTGAGCCCTGGGCTTAGGAGT CACCATGGCAACTGAAGAGTTCATCATCCGCATCCCCCCATACCACTATATCCATGTGCTGGACCAGAACAGCAACGTGTCCCGTGTGGA GGTCGGGCCAAAGACCTACATCCGGCAGGACAATGAGAGGTTCTGGATTTGGTGGACGCCGTCATCCTTACGGAAAAGACAGCCCTGCAC CTCCGGGCTCGGCGGAACTTCCGGGACTTCAGGGGAGTGTCCCGCCGCACTGGGGAGGAGTGGCTGGTAACAGTGCAGGACACAGAGGCC CACGTGCCAGATGTCCACGAGGAGGTGCTGGGGGTTGTGCCCATCACCACCCTGGGCCCCCACAACTACTGCGTGATTCTCGACCCTGTC GGACCGGATGGCAAGAATCAGCTGGGGCAGAAGCGCGTGGTCAAGGTCGGTCGGAGGCTCTGGCTGTGGATGGAGCTGGGAAGCCTGGGG CTGAGGAGGCTCAGGACCCCGAAGGGAAGGGAGAACAGGAGCACTCCCAGCAGAAAGAGGAGGAGGAGGAGATGGCAGTGGTCCCGCAAG GCCTCTTCCGGGGTGGGAAGAGCGGAGAGCTGGAGCAGGAGGAGGAGCGGCTCTCCAAGGAGTGGGAGGACTCCAAACGCTGGAGCAAGA TGGACCAGCTGGCCAAGGAGCTGACGGCTGAGAAGCGGCTGGAGGGGCAGGAGGAGGAGGAGGACAACCGGGACAGTTCCATGAAGCTCT CCTTCCGGGCCCGGGCCTACGGCTTCAGGGGCCCTGGGCCGCAGCTGCGACGAGGCTGGAGGCCATCCTCCCGGGAGGACAGCCTTGAGG CGGGCCTGCCCCTCCAGGTCCGAGGCTACCCCGAGGAGAAGAAAGAGGAGGAGGGCAGCGCAAACCGCAGACCAGAGGACCAGGAGCTGG AGAGCCTGTCGGCCATTGAAGCAGAGCTGGAGAAAGTGGCCCACCAGCTGCAGGCACTACGGCGGGGCTGAGACACCGGCTGGCAGGGCT GGCCCCAGGGCACCCTGTGGCCCTGGCTCTGCTGTCCCCTTGGCAGGTCCTGGCCAGATGGCCCGGATGCTGCTTCCGGTAGGGAGGCAG CCTCCAGCCTGCCCAAGCCCAGGCCACCCTATCGCCCCCTACGCGCCTTGTCTCCTACTCCTGACTCCTACCTGCCCTGGAACATCCTTT GCAGGGCAGCCCCACAACTTTAAACATTGACGATTCCTTCTCTGAACACAGGCAGCTTTCTAGAAGTTTCCCTTCCTCCATCCTATCCAC TGGGCACAACTGCAATAACTTCTGACCTTTTGGTGAAAGCTGAGAACTCCTGACTGTAACATATTCTGTATGAACTTTATCTAAAGAAAA >56102_56102_1_MVP-CHGA_MVP_chr16_29848279_ENST00000452209_CHGA_chr14_93398715_ENST00000216492_length(amino acids)=319AA_BP=131 MKSSSSASPHTTISMCWTRTATCPVWRSGQRPTSGRTMRGSGFGGRRHPYGKDSPAPPGSAELPGLQGSVPPHWGGVAGNSAGHRGPRAR CPRGGAGGCAHHHPGPPQLLRDSRPCRTGWQESAGAEARGQGRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFR GGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLP -------------------------------------------------------------- >56102_56102_2_MVP-CHGA_MVP_chr16_29848279_ENST00000452209_CHGA_chr14_93398715_ENST00000334654_length(transcript)=1430nt_BP=495nt AAGGCAGGGTGAGAGTTCCCCATCTGAGGCGTTTGTTGCAGCTACCTGCACTTCTAGATTCATCTTCTTGTGAGCCCTGGGCTTAGGAGT CACCATGGCAACTGAAGAGTTCATCATCCGCATCCCCCCATACCACTATATCCATGTGCTGGACCAGAACAGCAACGTGTCCCGTGTGGA GGTCGGGCCAAAGACCTACATCCGGCAGGACAATGAGAGGTTCTGGATTTGGTGGACGCCGTCATCCTTACGGAAAAGACAGCCCTGCAC CTCCGGGCTCGGCGGAACTTCCGGGACTTCAGGGGAGTGTCCCGCCGCACTGGGGAGGAGTGGCTGGTAACAGTGCAGGACACAGAGGCC CACGTGCCAGATGTCCACGAGGAGGTGCTGGGGGTTGTGCCCATCACCACCCTGGGCCCCCACAACTACTGCGTGATTCTCGACCCTGTC GGACCGGATGGCAAGAATCAGCTGGGGCAGAAGCGCGTGGTCAAGGTCGGTCGGAGGCTCTGGCTGTGGATGGAGCTGGGAAGCCTGGGG CTGAGGAGGCTCAGGACCCCGAAGGGAAGGGAGAACAGGAGCACTCCCAGCAGAAAGAGGAGGAGGAGGAGATGGCAGTGGTCCCGCAAG GCCTCTTCCGGGGTGGGAAGAGCGGAGAGCTGGAGCAGGAGGAGGAGCGGCTCTCCAAGGAGTGGGAGGACTCCAAACGCTGGAGCAAGA TGGACCAGCTGGCCAAGGAGCTGACGGCTGAGAAGCGGCTGGAGGGGCAGGAGGAGGAGGAGGACAACCGGGACAGTTCCATGAAGCTCT CCTTCCGGGCCCGGGCCTACGGCTTCAGGGGCCCTGGGCCGCAGCTGCGACGAGGCTGGAGGCCATCCTCCCGGGAGGACAGCCTTGAGG CGGGCCTGCCCCTCCAGGTCCGAGGCTACCCCGAGGAGAAGAAAGAGGAGGAGGGCAGCGCAAACCGCAGACCAGAGGACCAGGAGCTGG AGAGCCTGTCGGCCATTGAAGCAGAGCTGGAGAAAGTGGCCCACCAGCTGCAGGCACTACGGCGGGGCTGAGACACCGGCTGGCAGGGCT GGCCCCAGGGCACCCTGTGGCCCTGGCTCTGCTGTCCCCTTGGCAGGTCCTGGCCAGATGGCCCGGATGCTGCTTCCGGTAGGGAGGCAG CCTCCAGCCTGCCCAAGCCCAGGCCACCCTATCGCCCCCTACGCGCCTTGTCTCCTACTCCTGACTCCTACCTGCCCTGGAACATCCTTT GCAGGGCAGCCCCACAACTTTAAACATTGACGATTCCTTCTCTGAACACAGGCAGCTTTCTAGAAGTTTCCCTTCCTCCATCCTATCCAC >56102_56102_2_MVP-CHGA_MVP_chr16_29848279_ENST00000452209_CHGA_chr14_93398715_ENST00000334654_length(amino acids)=319AA_BP=131 MKSSSSASPHTTISMCWTRTATCPVWRSGQRPTSGRTMRGSGFGGRRHPYGKDSPAPPGSAELPGLQGSVPPHWGGVAGNSAGHRGPRAR CPRGGAGGCAHHHPGPPQLLRDSRPCRTGWQESAGAEARGQGRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFR GGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLP -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for MVP-CHGA |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for MVP-CHGA |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for MVP-CHGA |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |