|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:NCK1-HEBP1 (FusionGDB2 ID:57596) |
Fusion Gene Summary for NCK1-HEBP1 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: NCK1-HEBP1 | Fusion gene ID: 57596 | Hgene | Tgene | Gene symbol | NCK1 | HEBP1 | Gene ID | 4690 | 50865 |
| Gene name | NCK adaptor protein 1 | heme binding protein 1 | |
| Synonyms | NCK|NCKalpha|nck-1 | HBP|HEBP | |
| Cytomap | 3q22.3 | 12p13.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | cytoplasmic protein NCK1NCK tyrosine kinaseSH2/SH3 adaptor protein NCK-alphamelanoma NCK proteinnon-catalytic region of tyrosine kinase | heme-binding protein 1p22HBP | |
| Modification date | 20200327 | 20200313 | |
| UniProtAcc | P16333 | Q9NRV9 | |
| Ensembl transtripts involved in fusion gene | ENST00000288986, ENST00000469404, ENST00000481752, | ENST00000540916, ENST00000536942, ENST00000014930, | |
| Fusion gene scores | * DoF score | 8 X 7 X 10=560 | 5 X 2 X 3=30 |
| # samples | 15 | 4 | |
| ** MAII score | log2(15/560*10)=-1.90046432644909 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/30*10)=0.415037499278844 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
| Context | PubMed: NCK1 [Title/Abstract] AND HEBP1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | HEBP1(13140086)-NCK1(136667101), # samples:3 NCK1(136665137)-HEBP1(13128413), # samples:5 | ||
| Anticipated loss of major functional domain due to fusion event. | HEBP1-NCK1 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | NCK1 | GO:0033137 | negative regulation of peptidyl-serine phosphorylation | 14676213|16835242 |
| Hgene | NCK1 | GO:0036493 | positive regulation of translation in response to endoplasmic reticulum stress | 14676213 |
| Hgene | NCK1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 10026169 |
| Hgene | NCK1 | GO:0060548 | negative regulation of cell death | 18835251 |
| Hgene | NCK1 | GO:0070262 | peptidyl-serine dephosphorylation | 16835242 |
| Hgene | NCK1 | GO:1902237 | positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway | 14676213 |
| Hgene | NCK1 | GO:1903676 | positive regulation of cap-dependent translational initiation | 11959995 |
| Hgene | NCK1 | GO:1903679 | positive regulation of cap-independent translational initiation | 11959995 |
| Hgene | NCK1 | GO:1903898 | negative regulation of PERK-mediated unfolded protein response | 14676213 |
| Hgene | NCK1 | GO:1903912 | negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation | 14676213|16835242 |
| Hgene | NCK1 | GO:1990441 | negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress | 16835242 |
| Fusion gene breakpoints across NCK1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across HEBP1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | HNSC | TCGA-QK-A8ZB-01A | NCK1 | chr3 | 136665137 | - | HEBP1 | chr12 | 13128413 | - |
| ChimerDB4 | HNSC | TCGA-QK-A8ZB-01A | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - |
| ChimerDB4 | HNSC | TCGA-QK-A8ZB | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - |
Top |
Fusion Gene ORF analysis for NCK1-HEBP1 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| 5CDS-5UTR | ENST00000288986 | ENST00000540916 | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - |
| 5CDS-5UTR | ENST00000469404 | ENST00000540916 | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - |
| 5CDS-5UTR | ENST00000481752 | ENST00000540916 | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - |
| 5CDS-intron | ENST00000288986 | ENST00000536942 | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - |
| 5CDS-intron | ENST00000469404 | ENST00000536942 | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - |
| 5CDS-intron | ENST00000481752 | ENST00000536942 | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - |
| In-frame | ENST00000288986 | ENST00000014930 | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - |
| In-frame | ENST00000469404 | ENST00000014930 | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - |
| In-frame | ENST00000481752 | ENST00000014930 | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000288986 | NCK1 | chr3 | 136665137 | + | ENST00000014930 | HEBP1 | chr12 | 13128413 | - | 1685 | 1069 | 130 | 1185 | 351 |
| ENST00000481752 | NCK1 | chr3 | 136665137 | + | ENST00000014930 | HEBP1 | chr12 | 13128413 | - | 1719 | 1103 | 164 | 1219 | 351 |
| ENST00000469404 | NCK1 | chr3 | 136665137 | + | ENST00000014930 | HEBP1 | chr12 | 13128413 | - | 1454 | 838 | 91 | 954 | 287 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000288986 | ENST00000014930 | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - | 0.000407328 | 0.9995927 |
| ENST00000481752 | ENST00000014930 | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - | 0.00050991 | 0.99949 |
| ENST00000469404 | ENST00000014930 | NCK1 | chr3 | 136665137 | + | HEBP1 | chr12 | 13128413 | - | 0.000474786 | 0.9995252 |
Top |
Fusion Genomic Features for NCK1-HEBP1 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for NCK1-HEBP1 |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr3:13140086/chr12:136667101) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| NCK1 | HEBP1 |
| FUNCTION: Adapter protein which associates with tyrosine-phosphorylated growth factor receptors, such as KDR and PDGFRB, or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. Plays a role in the DNA damage response, not in the detection of the damage by ATM/ATR, but for efficient activation of downstream effectors, such as that of CHEK2. Plays a role in ELK1-dependent transcriptional activation in response to activated Ras signaling. Modulates the activation of EIF2AK2/PKR by dsRNA. May play a role in cell adhesion and migration through interaction with ephrin receptors. {ECO:0000269|PubMed:10026169, ECO:0000269|PubMed:16835242, ECO:0000269|PubMed:17803907, ECO:0000269|PubMed:18835251, ECO:0000269|PubMed:23358419, ECO:0000269|PubMed:9430661}. | FUNCTION: May bind free porphyrinogens that may be present in the cell and thus facilitate removal of these potentially toxic compound. Binds with a high affinity to one molecule of heme or porphyrins. It binds metalloporphyrins, free porphyrins and N-methylprotoporphyrin with similar affinities. {ECO:0000269|PubMed:12413491}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | NCK1 | chr3:136665137 | chr12:13128413 | ENST00000288986 | + | 3 | 4 | 106_165 | 313 | 378.0 | Domain | SH3 2 |
| Hgene | NCK1 | chr3:136665137 | chr12:13128413 | ENST00000288986 | + | 3 | 4 | 190_252 | 313 | 378.0 | Domain | SH3 3 |
| Hgene | NCK1 | chr3:136665137 | chr12:13128413 | ENST00000288986 | + | 3 | 4 | 2_61 | 313 | 378.0 | Domain | SH3 1 |
| Hgene | NCK1 | chr3:136665137 | chr12:13128413 | ENST00000469404 | + | 2 | 3 | 106_165 | 249 | 314.0 | Domain | SH3 2 |
| Hgene | NCK1 | chr3:136665137 | chr12:13128413 | ENST00000469404 | + | 2 | 3 | 190_252 | 249 | 314.0 | Domain | SH3 3 |
| Hgene | NCK1 | chr3:136665137 | chr12:13128413 | ENST00000469404 | + | 2 | 3 | 2_61 | 249 | 314.0 | Domain | SH3 1 |
| Hgene | NCK1 | chr3:136665137 | chr12:13128413 | ENST00000481752 | + | 3 | 4 | 106_165 | 313 | 378.0 | Domain | SH3 2 |
| Hgene | NCK1 | chr3:136665137 | chr12:13128413 | ENST00000481752 | + | 3 | 4 | 190_252 | 313 | 378.0 | Domain | SH3 3 |
| Hgene | NCK1 | chr3:136665137 | chr12:13128413 | ENST00000481752 | + | 3 | 4 | 2_61 | 313 | 378.0 | Domain | SH3 1 |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | NCK1 | chr3:136665137 | chr12:13128413 | ENST00000288986 | + | 3 | 4 | 282_376 | 313 | 378.0 | Domain | SH2 |
| Hgene | NCK1 | chr3:136665137 | chr12:13128413 | ENST00000469404 | + | 2 | 3 | 282_376 | 249 | 314.0 | Domain | SH2 |
| Hgene | NCK1 | chr3:136665137 | chr12:13128413 | ENST00000481752 | + | 3 | 4 | 282_376 | 313 | 378.0 | Domain | SH2 |
Top |
Fusion Gene Sequence for NCK1-HEBP1 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >57596_57596_1_NCK1-HEBP1_NCK1_chr3_136665137_ENST00000288986_HEBP1_chr12_13128413_ENST00000014930_length(transcript)=1685nt_BP=1069nt ACCGCGCGTGCCCCGCCTCTCTCCCAAGAGCTACGCGGCGGCGGCGGAGCGCAGGCCTCGTGCCGTTACGGCCATCACGGCGGCCGCAGT GGCGTCCTGGAGCCCTCCTCAGTGCTGAAGCTGCTGAAAGATGGCAGAAGAAGTGGTGGTAGTAGCCAAATTTGATTATGTGGCCCAACA AGAACAAGAGTTGGACATCAAGAAGAATGAGAGATTATGGCTTCTGGATGATTCTAAGTCCTGGTGGCGAGTTCGAAATTCCATGAATAA AACAGGTTTTGTGCCTTCTAACTATGTGGAAAGGAAAAACAGTGCTCGGAAAGCATCTATTGTGAAAAACCTAAAGGATACCTTAGGCAT TGGAAAAGTGAAAAGAAAACCTAGTGTGCCAGATTCTGCATCTCCTGCTGATGATAGTTTTGTTGACCCAGGGGAACGTCTCTATGACCT CAACATGCCCGCTTATGTGAAATTTAACTACATGGCTGAGAGAGAGGATGAATTATCATTGATAAAGGGGACAAAGGTGATCGTCATGGA GAAATGCAGTGATGGGTGGTGGCGTGGTAGCTACAATGGACAAGTTGGATGGTTCCCTTCAAACTATGTAACTGAAGAAGGTGACAGTCC TTTGGGTGACCATGTGGGTTCTCTGTCAGAGAAATTAGCAGCAGTCGTCAATAACCTAAATACTGGGCAAGTGTTGCATGTGGTACAGGC TCTTTACCCATTCAGCTCATCTAATGATGAAGAACTTAATTTCGAGAAAGGAGATGTAATGGATGTTATTGAAAAACCTGAAAATGACCC AGAGTGGTGGAAATGCAGGAAGATCAATGGTATGGTTGGTCTAGTACCAAAAAACTATGTTACCGTTATGCAGAATAATCCATTAACTTC AGGTTTGGAACCATCACCTCCACAGTGTGATTACATTAGGCCTTCACTCACTGGAAAGTTTGCTGGCAATCCTTGGTATTATGGCAAAGT CACCAGGCATCAAGCAGAAATGGCATTAAATGAAAGAGGACATGAAGGGGATTTCCTCATTCGTGATAGTGAATCTTCGGCAGTTTGGTG GTTATGCCAAGGAAGCAGACTACGTAGCACAAGCCACCCGTCTGCGTGCTGCCCTGGAGGGCACAGCCACCTACCGGGGGGACATCTACT TCTGCACGGGTTATGACCCTCCCATGAAGCCCTACGGACGGCGCAATGAGATCTGGCTGTTGAAGACATGAGTGACCCACTGAACCAAGA ACTTACTGGAAGTGTGCCTCTGTGTCTCCTTCCTCGGGGGTAAGGAGGGGACAGTGCTTCCCAAGTTCCAGCTGCAAGTCCAACTTAACC AACTTTCCTTCAAAGTCAGTTACTGCCAATTTTCTGAAAAAAGCATGTTCCATATACTAAGTCTCTTTTCTCACAGTAGGAAATAATACA GCCAAGATATGCAGCATCCTTCTCATTGATGTAGAAAATTCTGCGATAGACCAGAAAAATCCTGGCAGCTTTTCTCCAGGCATCTGGGTC ACTAAAAACTGATTTTCTAAAATTATTGGATTTGTATTTTGTTATTAAGGGGGAAAATGTGATTTGTGCCTGATCTTTCATCTGTGATTC >57596_57596_1_NCK1-HEBP1_NCK1_chr3_136665137_ENST00000288986_HEBP1_chr12_13128413_ENST00000014930_length(amino acids)=351AA_BP=313 MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSA SPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIR -------------------------------------------------------------- >57596_57596_2_NCK1-HEBP1_NCK1_chr3_136665137_ENST00000469404_HEBP1_chr12_13128413_ENST00000014930_length(transcript)=1454nt_BP=838nt GTTTCAGTGTTGCAGAACAGACGAGGAAGCTCACTGAGAATTATCCTGAGCTGTGTTAACAAACTGACAGAACACAGAATTTTTACTCAA AATGGATTGGTTAAACGTCTTTAAAGATTTTTTCAGCATTGGAAAAGTGAAAAGAAAACCTAGTGTGCCAGATTCTGCATCTCCTGCTGA TGATAGTTTTGTTGACCCAGGGGAACGTCTCTATGACCTCAACATGCCCGCTTATGTGAAATTTAACTACATGGCTGAGAGAGAGGATGA ATTATCATTGATAAAGGGGACAAAGGTGATCGTCATGGAGAAATGCAGTGATGGGTGGTGGCGTGGTAGCTACAATGGACAAGTTGGATG GTTCCCTTCAAACTATGTAACTGAAGAAGGTGACAGTCCTTTGGGTGACCATGTGGGTTCTCTGTCAGAGAAATTAGCAGCAGTCGTCAA TAACCTAAATACTGGGCAAGTGTTGCATGTGGTACAGGCTCTTTACCCATTCAGCTCATCTAATGATGAAGAACTTAATTTCGAGAAAGG AGATGTAATGGATGTTATTGAAAAACCTGAAAATGACCCAGAGTGGTGGAAATGCAGGAAGATCAATGGTATGGTTGGTCTAGTACCAAA AAACTATGTTACCGTTATGCAGAATAATCCATTAACTTCAGGTTTGGAACCATCACCTCCACAGTGTGATTACATTAGGCCTTCACTCAC TGGAAAGTTTGCTGGCAATCCTTGGTATTATGGCAAAGTCACCAGGCATCAAGCAGAAATGGCATTAAATGAAAGAGGACATGAAGGGGA TTTCCTCATTCGTGATAGTGAATCTTCGGCAGTTTGGTGGTTATGCCAAGGAAGCAGACTACGTAGCACAAGCCACCCGTCTGCGTGCTG CCCTGGAGGGCACAGCCACCTACCGGGGGGACATCTACTTCTGCACGGGTTATGACCCTCCCATGAAGCCCTACGGACGGCGCAATGAGA TCTGGCTGTTGAAGACATGAGTGACCCACTGAACCAAGAACTTACTGGAAGTGTGCCTCTGTGTCTCCTTCCTCGGGGGTAAGGAGGGGA CAGTGCTTCCCAAGTTCCAGCTGCAAGTCCAACTTAACCAACTTTCCTTCAAAGTCAGTTACTGCCAATTTTCTGAAAAAAGCATGTTCC ATATACTAAGTCTCTTTTCTCACAGTAGGAAATAATACAGCCAAGATATGCAGCATCCTTCTCATTGATGTAGAAAATTCTGCGATAGAC CAGAAAAATCCTGGCAGCTTTTCTCCAGGCATCTGGGTCACTAAAAACTGATTTTCTAAAATTATTGGATTTGTATTTTGTTATTAAGGG GGAAAATGTGATTTGTGCCTGATCTTTCATCTGTGATTCTTATAAGAGCTTTGTCTTCAGAAAAACTAAAAATAAAAGGCATTGACTTAA >57596_57596_2_NCK1-HEBP1_NCK1_chr3_136665137_ENST00000469404_HEBP1_chr12_13128413_ENST00000014930_length(amino acids)=287AA_BP=249 MDWLNVFKDFFSIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGW FPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPK NYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESSAVWWLCQGSRLRSTSHPSACC -------------------------------------------------------------- >57596_57596_3_NCK1-HEBP1_NCK1_chr3_136665137_ENST00000481752_HEBP1_chr12_13128413_ENST00000014930_length(transcript)=1719nt_BP=1103nt ACCGCGCGTGCCCCGCCTCTCTCCCAAGAGCTACGCGGCGGCGGCGGAGCGCAGGCCTCGTGCCGTTACGGCCATCACGGCGGCCGCAGT GGCGTCCTGGAGCCCTCCTCAGGTGAGCTGGAGCTGCCCGGCTCGGCAGCGGGAAGTGCTGAAGCTGCTGAAAGATGGCAGAAGAAGTGG TGGTAGTAGCCAAATTTGATTATGTGGCCCAACAAGAACAAGAGTTGGACATCAAGAAGAATGAGAGATTATGGCTTCTGGATGATTCTA AGTCCTGGTGGCGAGTTCGAAATTCCATGAATAAAACAGGTTTTGTGCCTTCTAACTATGTGGAAAGGAAAAACAGTGCTCGGAAAGCAT CTATTGTGAAAAACCTAAAGGATACCTTAGGCATTGGAAAAGTGAAAAGAAAACCTAGTGTGCCAGATTCTGCATCTCCTGCTGATGATA GTTTTGTTGACCCAGGGGAACGTCTCTATGACCTCAACATGCCCGCTTATGTGAAATTTAACTACATGGCTGAGAGAGAGGATGAATTAT CATTGATAAAGGGGACAAAGGTGATCGTCATGGAGAAATGCAGTGATGGGTGGTGGCGTGGTAGCTACAATGGACAAGTTGGATGGTTCC CTTCAAACTATGTAACTGAAGAAGGTGACAGTCCTTTGGGTGACCATGTGGGTTCTCTGTCAGAGAAATTAGCAGCAGTCGTCAATAACC TAAATACTGGGCAAGTGTTGCATGTGGTACAGGCTCTTTACCCATTCAGCTCATCTAATGATGAAGAACTTAATTTCGAGAAAGGAGATG TAATGGATGTTATTGAAAAACCTGAAAATGACCCAGAGTGGTGGAAATGCAGGAAGATCAATGGTATGGTTGGTCTAGTACCAAAAAACT ATGTTACCGTTATGCAGAATAATCCATTAACTTCAGGTTTGGAACCATCACCTCCACAGTGTGATTACATTAGGCCTTCACTCACTGGAA AGTTTGCTGGCAATCCTTGGTATTATGGCAAAGTCACCAGGCATCAAGCAGAAATGGCATTAAATGAAAGAGGACATGAAGGGGATTTCC TCATTCGTGATAGTGAATCTTCGGCAGTTTGGTGGTTATGCCAAGGAAGCAGACTACGTAGCACAAGCCACCCGTCTGCGTGCTGCCCTG GAGGGCACAGCCACCTACCGGGGGGACATCTACTTCTGCACGGGTTATGACCCTCCCATGAAGCCCTACGGACGGCGCAATGAGATCTGG CTGTTGAAGACATGAGTGACCCACTGAACCAAGAACTTACTGGAAGTGTGCCTCTGTGTCTCCTTCCTCGGGGGTAAGGAGGGGACAGTG CTTCCCAAGTTCCAGCTGCAAGTCCAACTTAACCAACTTTCCTTCAAAGTCAGTTACTGCCAATTTTCTGAAAAAAGCATGTTCCATATA CTAAGTCTCTTTTCTCACAGTAGGAAATAATACAGCCAAGATATGCAGCATCCTTCTCATTGATGTAGAAAATTCTGCGATAGACCAGAA AAATCCTGGCAGCTTTTCTCCAGGCATCTGGGTCACTAAAAACTGATTTTCTAAAATTATTGGATTTGTATTTTGTTATTAAGGGGGAAA ATGTGATTTGTGCCTGATCTTTCATCTGTGATTCTTATAAGAGCTTTGTCTTCAGAAAAACTAAAAATAAAAGGCATTGACTTAAACAGC >57596_57596_3_NCK1-HEBP1_NCK1_chr3_136665137_ENST00000481752_HEBP1_chr12_13128413_ENST00000014930_length(amino acids)=351AA_BP=313 MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSA SPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIR -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for NCK1-HEBP1 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for NCK1-HEBP1 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for NCK1-HEBP1 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies