|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:NR2F2-B2M (FusionGDB2 ID:60137) |
Fusion Gene Summary for NR2F2-B2M |
Fusion gene summary |
Fusion gene information | Fusion gene name: NR2F2-B2M | Fusion gene ID: 60137 | Hgene | Tgene | Gene symbol | NR2F2 | B2M | Gene ID | 7026 | 567 |
Gene name | nuclear receptor subfamily 2 group F member 2 | beta-2-microglobulin | |
Synonyms | ARP-1|ARP1|CHTD4|COUPTF2|COUPTFB|COUPTFII|NF-E3|SVP40|TFCOUP2 | IMD43 | |
Cytomap | 15q26.2 | 15q21.1 | |
Type of gene | protein-coding | protein-coding | |
Description | COUP transcription factor 2ADP-ribosylation factor related protein 1COUP transcription factor IIapolipoprotein A-I regulatory protein 1apolipoprotein AI regulatory protein 1chicken ovalbumin upstream promoter transcription factor 2chicken ovalbumin | beta-2-microglobulinbeta chain of MHC class I moleculesbeta-2-microglobin | |
Modification date | 20200313 | 20200329 | |
UniProtAcc | P24468 | P61769 | |
Ensembl transtripts involved in fusion gene | ENST00000421109, ENST00000394166, ENST00000394171, ENST00000453270, | ENST00000559220, ENST00000544417, ENST00000558401, ENST00000559916, | |
Fusion gene scores | * DoF score | 12 X 9 X 4=432 | 64 X 31 X 17=33728 |
# samples | 13 | 71 | |
** MAII score | log2(13/432*10)=-1.73251968913501 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(71/33728*10)=-5.56998393724517 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: NR2F2 [Title/Abstract] AND B2M [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | NR2F2(96869581)-B2M(45007621), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | NR2F2-B2M seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. NR2F2-B2M seems lost the major protein functional domain in Hgene partner, which is a transcription factor due to the frame-shifted ORF. NR2F2-B2M seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | NR2F2 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 9343308 |
Hgene | NR2F2 | GO:0045736 | negative regulation of cyclin-dependent protein serine/threonine kinase activity | 19210544 |
Hgene | NR2F2 | GO:0045892 | negative regulation of transcription, DNA-templated | 19210544 |
Hgene | NR2F2 | GO:0045893 | positive regulation of transcription, DNA-templated | 18798693 |
Tgene | B2M | GO:0002726 | positive regulation of T cell cytokine production | 24643698 |
Tgene | B2M | GO:0007611 | learning or memory | 26147761 |
Tgene | B2M | GO:0050680 | negative regulation of epithelial cell proliferation | 28213472 |
Tgene | B2M | GO:0050768 | negative regulation of neurogenesis | 26147761 |
Tgene | B2M | GO:0090647 | modulation of age-related behavioral decline | 26147761 |
Tgene | B2M | GO:1900121 | negative regulation of receptor binding | 9465039 |
Tgene | B2M | GO:1990000 | amyloid fibril formation | 28468825 |
Tgene | B2M | GO:2000774 | positive regulation of cellular senescence | 28213472 |
Tgene | B2M | GO:2000978 | negative regulation of forebrain neuron differentiation | 26147761 |
Fusion gene breakpoints across NR2F2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across B2M (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | CESC | TCGA-EK-A2R7-01A | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
Top |
Fusion Gene ORF analysis for NR2F2-B2M |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000421109 | ENST00000559220 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
Frame-shift | ENST00000421109 | ENST00000544417 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
In-frame | ENST00000421109 | ENST00000558401 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
In-frame | ENST00000421109 | ENST00000559916 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000394166 | ENST00000544417 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000394166 | ENST00000558401 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000394166 | ENST00000559916 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000394171 | ENST00000544417 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000394171 | ENST00000558401 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000394171 | ENST00000559916 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000453270 | ENST00000544417 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000453270 | ENST00000558401 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
intron-3CDS | ENST00000453270 | ENST00000559916 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
intron-intron | ENST00000394166 | ENST00000559220 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
intron-intron | ENST00000394171 | ENST00000559220 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
intron-intron | ENST00000453270 | ENST00000559220 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000421109 | NR2F2 | chr15 | 96869581 | + | ENST00000558401 | B2M | chr15 | 45007621 | + | 1993 | 415 | 372 | 707 | 111 |
ENST00000421109 | NR2F2 | chr15 | 96869581 | + | ENST00000559916 | B2M | chr15 | 45007621 | + | 1395 | 415 | 1275 | 934 | 113 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000421109 | ENST00000558401 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + | 0.0584083 | 0.9415917 |
ENST00000421109 | ENST00000559916 | NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007621 | + | 0.03656785 | 0.9634322 |
Top |
Fusion Genomic Features for NR2F2-B2M |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007620 | + | 8.25E-05 | 0.9999175 |
NR2F2 | chr15 | 96869581 | + | B2M | chr15 | 45007620 | + | 8.25E-05 | 0.9999175 |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for NR2F2-B2M |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr15:96869581/chr15:45007621) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
NR2F2 | B2M |
FUNCTION: Ligand-activated transcription factor. Activated by high concentrations of 9-cis-retinoic acid and all-trans-retinoic acid, but not by dexamethasone, cortisol or progesterone (in vitro). Regulation of the apolipoprotein A-I gene transcription. Binds to DNA site A. May be required to establish ovary identity during early gonad development (PubMed:29478779). {ECO:0000269|PubMed:18798693, ECO:0000269|PubMed:1899293, ECO:0000269|PubMed:29478779, ECO:0000269|PubMed:9343308}. | FUNCTION: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. Exogenously applied M.tuberculosis EsxA or EsxA-EsxB (or EsxA expressed in host) binds B2M and decreases its export to the cell surface (total protein levels do not change), probably leading to defects in class I antigen presentation (PubMed:25356553). {ECO:0000269|PubMed:25356553}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | B2M | chr15:96869581 | chr15:45007621 | ENST00000558401 | 0 | 4 | 25_113 | 22 | 498.0 | Domain | Note=Ig-like C1-type | |
Tgene | B2M | chr15:96869581 | chr15:45007621 | ENST00000559916 | 0 | 3 | 25_113 | 22 | 120.0 | Domain | Note=Ig-like C1-type |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394166 | + | 1 | 3 | 71_75 | 0 | 415.0 | Compositional bias | Note=Poly-Gln |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394171 | + | 1 | 3 | 71_75 | 0 | 262.0 | Compositional bias | Note=Poly-Gln |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000421109 | + | 1 | 3 | 71_75 | 14 | 282.0 | Compositional bias | Note=Poly-Gln |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000453270 | + | 1 | 3 | 71_75 | 0 | 262.0 | Compositional bias | Note=Poly-Gln |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394166 | + | 1 | 3 | 76_151 | 0 | 415.0 | DNA binding | Nuclear receptor |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394171 | + | 1 | 3 | 76_151 | 0 | 262.0 | DNA binding | Nuclear receptor |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000421109 | + | 1 | 3 | 76_151 | 14 | 282.0 | DNA binding | Nuclear receptor |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000453270 | + | 1 | 3 | 76_151 | 0 | 262.0 | DNA binding | Nuclear receptor |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394166 | + | 1 | 3 | 177_403 | 0 | 415.0 | Domain | NR LBD |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394171 | + | 1 | 3 | 177_403 | 0 | 262.0 | Domain | NR LBD |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000421109 | + | 1 | 3 | 177_403 | 14 | 282.0 | Domain | NR LBD |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000453270 | + | 1 | 3 | 177_403 | 0 | 262.0 | Domain | NR LBD |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394166 | + | 1 | 3 | 337_414 | 0 | 415.0 | Region | Note=Important for dimerization |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394171 | + | 1 | 3 | 337_414 | 0 | 262.0 | Region | Note=Important for dimerization |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000421109 | + | 1 | 3 | 337_414 | 14 | 282.0 | Region | Note=Important for dimerization |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000453270 | + | 1 | 3 | 337_414 | 0 | 262.0 | Region | Note=Important for dimerization |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394166 | + | 1 | 3 | 115_139 | 0 | 415.0 | Zinc finger | NR C4-type |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394166 | + | 1 | 3 | 79_99 | 0 | 415.0 | Zinc finger | NR C4-type |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394171 | + | 1 | 3 | 115_139 | 0 | 262.0 | Zinc finger | NR C4-type |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394171 | + | 1 | 3 | 79_99 | 0 | 262.0 | Zinc finger | NR C4-type |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000421109 | + | 1 | 3 | 115_139 | 14 | 282.0 | Zinc finger | NR C4-type |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000421109 | + | 1 | 3 | 79_99 | 14 | 282.0 | Zinc finger | NR C4-type |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000453270 | + | 1 | 3 | 115_139 | 0 | 262.0 | Zinc finger | NR C4-type |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000453270 | + | 1 | 3 | 79_99 | 0 | 262.0 | Zinc finger | NR C4-type |
Top |
Fusion Gene Sequence for NR2F2-B2M |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>60137_60137_1_NR2F2-B2M_NR2F2_chr15_96869581_ENST00000421109_B2M_chr15_45007621_ENST00000558401_length(transcript)=1993nt_BP=415nt AGGATCACTCCAGACATCTCCTACCTACGGTTTGGGGTTTTTTTTCTTAAAGGCGAGGCTTGCATTCCTCAGCAGCTATGTACAAAGCTC CCTGAAACCTTGTCTCTCTAAAGTTAGTGTGCAGGGTTTTCCAAGGCTGAGAGAGCCTAATACATGGGGAAGCACTTCCTTGAGGTGGAA GATCTCTCCCTTCACCTTTCCTCTTTTTCCCTGCAGGCTAGTGCCTACTTTTTATCAGTTTGCACAATCGCTTAGATAAACACCGAGGAG GAGATTCTCTTTAATTATCAAAGACACATCTTTTCAGGGGGCCAACAAAGCATTTATTTCACCCGCCAAACTAAAGGAGAGTTATTCCAG TTTAGGAGGAAGATGCAAGCGGTTTGGGACCTTGAACAAGGCAAATATGGTTTTGGTACTCCAAAGATTCAGGTTTACTCACGTCATCCA GCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGTGTCTGGGTTTCATCCATCCGACATTGAAGTTGACTTACTGAAGAATGGAGAG AGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTGAA AAAGATGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGATCGAGACATGTAAGCAGCATCATGG AGGTTTGAAGATGCCGCATTTGGATTGGATGAATTCCAAATTCTGCTTGCTTGCTTTTTAATATTGATATGCTTATACACTTACACTTTA TGCACAAAATGTAGGGTTATAATAATGTTAACATGGACATGATCTTCTTTATAATTCTACTTTGAGTGCTGTCTCCATGTTTGATGTATC TGAGCAGGTTGCTCCACAGGTAGCTCTAGGAGGGCTGGCAACTTAGAGGTGGGGAGCAGAGAATTCTCTTATCCAACATCAACATCTTGG TCAGATTTGAACTCTTCAATCTCTTGCACTCAAAGCTTGTTAAGATAGTTAAGCGTGCATAAGTTAACTTCCAATTTACATACTCTGCTT AGAATTTGGGGGAAAATTTAGAAATATAATTGACAGGATTATTGGAAATTTGTTATAATGAATGAAACATTTTGTCATATAAGATTCATA TTTACTTCTTATACATTTGATAAAGTAAGGCATGGTTGTGGTTAATCTGGTTTATTTTTGTTCCACAAGTTAAATAAATCATAAAACTTG ATGTGTTATCTCTTATATCTCACTCCCACTATTACCCCTTTATTTTCAAACAGGGAAACAGTCTTCAAGTTCCACTTGGTAAAAAATGTG AACCCCTTGTATATAGAGTTTGGCTCACAGTGTAAAGGGCCTCAGTGATTCACATTTTCCAGATTAGGAATCTGATGCTCAAAGAAGTTA AATGGCATAGTTGGGGTGACACAGCTGTCTAGTGGGAGGCCAGCCTTCTATATTTTAGCCAGCGTTCTTTCCTGCGGGCCAGGTCATGAG GAGTATGCAGACTCTAAGAGGGAGCAAAAGTATCTGAAGGATTTAATATTTTAGCAAGGAATAGATATACAATCATCCCTTGGTCTCCCT GGGGGATTGGTTTCAGGACCCCTTCTTGGACACCAAATCTATGGATATTTAAGTCCCTTCTATAAAATGGTATAGTATTTGCATATAACC TATCCACATCCTCCTGTATACTTTAAATCATTTCTAGATTACTTGTAATACCTAATACAATGTAAATGCTATGCAAATAGTTGTTATTGT TTAAGGAATAATGACAAGAAAAAAAAGTCTGTACATGCTCAGTAAAGACACAACCATCCCTTTTTTTCCCCAGTGTTTTTGATCCATGGT TTGCTGAATCCACAGATGTGGAGCCCCTGGATACGGAAGGCCCGCTGTACTTTGAATGACAAATAACAGATTTAAAATTTTCAAGGCATA >60137_60137_1_NR2F2-B2M_NR2F2_chr15_96869581_ENST00000421109_B2M_chr15_45007621_ENST00000558401_length(amino acids)=111AA_BP=14 MQAVWDLEQGKYGFGTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEY -------------------------------------------------------------- >60137_60137_2_NR2F2-B2M_NR2F2_chr15_96869581_ENST00000421109_B2M_chr15_45007621_ENST00000559916_length(transcript)=1395nt_BP=415nt AGGATCACTCCAGACATCTCCTACCTACGGTTTGGGGTTTTTTTTCTTAAAGGCGAGGCTTGCATTCCTCAGCAGCTATGTACAAAGCTC CCTGAAACCTTGTCTCTCTAAAGTTAGTGTGCAGGGTTTTCCAAGGCTGAGAGAGCCTAATACATGGGGAAGCACTTCCTTGAGGTGGAA GATCTCTCCCTTCACCTTTCCTCTTTTTCCCTGCAGGCTAGTGCCTACTTTTTATCAGTTTGCACAATCGCTTAGATAAACACCGAGGAG GAGATTCTCTTTAATTATCAAAGACACATCTTTTCAGGGGGCCAACAAAGCATTTATTTCACCCGCCAAACTAAAGGAGAGTTATTCCAG TTTAGGAGGAAGATGCAAGCGGTTTGGGACCTTGAACAAGGCAAATATGGTTTTGGTACTCCAAAGATTCAGGTTTACTCACGTCATCCA GCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGTGTCTGGGTTTCATCCATCCGACATTGAAGTTGACTTACTGAAGAATGGAGAG AGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTGAA AAAGATGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGATCGAGACATGTAAGCAGCATCATGG AGGTAAGTTTTTGACCTTGAGAAAATGTTTTTGTTTCACTGTCCTGAGGACTATTTATAGACAGCTCTAACATGATAACCCTCACTATGT GGAGAACATTGACAGAGTAACATTTTAGCAGGGAAAGAAGAATCCTACAGGGTCATGTTCCCTTCTCCTGTGGAGTGGCATGAAGAAGGT GTATGGCCCCAGGTATGGCCATATTACTGACCCTCTACAGAGAGGGCAAAGGAACTGCCAGTATGGTATTGCAGGATAAAGGCAGGTGGT TACCCACATTACCTGCAAGGCTTTGATCTTTCTTCTGCCATTTCCACATTGGACATCTCTGCTGAGGAGAGAAAATGAACCACTCTTTTC CTTTGTATAATGTTGTTTTATTCTTCAGACAGAAGAGAGGAGTTATACAGCTCTGCAGACATCCCATTCCTGTATGGGGACTGTGTTTGC CTCTTAGAGGTTCCCAGGCCACTAGAGGAGATAAAGGGAAACAGATTGTTATAACTTGATATAATGATACTATAATAGATGTAACTACAA GGAGCTCCAGAAGCAAGAGAGAGGGAGGAACTTGGACTTCTCTGCATCTTTAGTTGGAGTCCAAAGGCTTTTCAATGAAATTCTACTGCC >60137_60137_2_NR2F2-B2M_NR2F2_chr15_96869581_ENST00000421109_B2M_chr15_45007621_ENST00000559916_length(amino acids)=113AA_BP= MLLELLVVTSIIVSLYQVITICFPLSPLVAWEPLRGKHSPHTGMGCLQSCITPLFCLKNKTTLYKGKEWFIFSPQQRCPMWKWQKKDQSL -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for NR2F2-B2M |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394166 | + | 1 | 3 | 117_414 | 0 | 415.0 | ZFPM2 |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000394171 | + | 1 | 3 | 117_414 | 0 | 262.0 | ZFPM2 |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000421109 | + | 1 | 3 | 117_414 | 14.333333333333334 | 282.0 | ZFPM2 |
Hgene | NR2F2 | chr15:96869581 | chr15:45007621 | ENST00000453270 | + | 1 | 3 | 117_414 | 0 | 262.0 | ZFPM2 |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for NR2F2-B2M |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for NR2F2-B2M |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |