|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:PASK-BOK (FusionGDB2 ID:62895) |
Fusion Gene Summary for PASK-BOK |
Fusion gene summary |
Fusion gene information | Fusion gene name: PASK-BOK | Fusion gene ID: 62895 | Hgene | Tgene | Gene symbol | PASK | BOK | Gene ID | 27347 | 666 |
Gene name | serine/threonine kinase 39 | BCL2 family apoptosis regulator BOK | |
Synonyms | DCHT|PASK|SPAK | BCL2L9|BOKL | |
Cytomap | 2q24.3 | 2q37.3 | |
Type of gene | protein-coding | protein-coding | |
Description | STE20/SPS1-related proline-alanine-rich protein kinaseSTE20/SPS1 homologSte20-like protein kinaseproline-alanine-rich STE20-related kinaseserine threonine kinase 39 (STE20/SPS1 homolog, yeast)serine/threonine-protein kinase 39small intestine SPAK-li | bcl-2-related ovarian killer proteinBCL2 related ovarian killerBOK, BCL2 family apoptosis regulatorbcl-2-like protein 9bcl2-L-9hBOK | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | . | Q9UMX3 | |
Ensembl transtripts involved in fusion gene | ENST00000234040, ENST00000358649, ENST00000403638, ENST00000405260, ENST00000475666, ENST00000539818, ENST00000544142, | ENST00000318407, | |
Fusion gene scores | * DoF score | 3 X 3 X 3=27 | 2 X 1 X 2=4 |
# samples | 3 | 2 | |
** MAII score | log2(3/27*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(2/4*10)=2.32192809488736 | |
Context | PubMed: PASK [Title/Abstract] AND BOK [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | PASK(242079936)-BOK(242509540), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | PASK-BOK seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. PASK-BOK seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | PASK | GO:0018105 | peptidyl-serine phosphorylation | 24393035 |
Hgene | PASK | GO:0018107 | peptidyl-threonine phosphorylation | 24393035 |
Hgene | PASK | GO:0023014 | signal transduction by protein phosphorylation | 24393035 |
Hgene | PASK | GO:0035556 | intracellular signal transduction | 24393035 |
Hgene | PASK | GO:1901017 | negative regulation of potassium ion transmembrane transporter activity | 24393035 |
Hgene | PASK | GO:1901380 | negative regulation of potassium ion transmembrane transport | 24393035 |
Hgene | PASK | GO:1905408 | negative regulation of creatine transmembrane transporter activity | 25531585 |
Hgene | PASK | GO:2000650 | negative regulation of sodium ion transmembrane transporter activity | 25531585 |
Tgene | BOK | GO:0001836 | release of cytochrome c from mitochondria | 27505430 |
Tgene | BOK | GO:0006915 | apoptotic process | 15102863 |
Tgene | BOK | GO:0043065 | positive regulation of apoptotic process | 16302269|27505430 |
Tgene | BOK | GO:1901382 | regulation of chorionic trophoblast cell proliferation | 19942931 |
Fusion gene breakpoints across PASK (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across BOK (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LUAD | TCGA-55-6985-01A | PASK | chr2 | 242079936 | - | BOK | chr2 | 242509540 | + |
Top |
Fusion Gene ORF analysis for PASK-BOK |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
Frame-shift | ENST00000234040 | ENST00000318407 | PASK | chr2 | 242079936 | - | BOK | chr2 | 242509540 | + |
Frame-shift | ENST00000358649 | ENST00000318407 | PASK | chr2 | 242079936 | - | BOK | chr2 | 242509540 | + |
Frame-shift | ENST00000403638 | ENST00000318407 | PASK | chr2 | 242079936 | - | BOK | chr2 | 242509540 | + |
In-frame | ENST00000405260 | ENST00000318407 | PASK | chr2 | 242079936 | - | BOK | chr2 | 242509540 | + |
intron-3CDS | ENST00000475666 | ENST00000318407 | PASK | chr2 | 242079936 | - | BOK | chr2 | 242509540 | + |
intron-3CDS | ENST00000539818 | ENST00000318407 | PASK | chr2 | 242079936 | - | BOK | chr2 | 242509540 | + |
intron-3CDS | ENST00000544142 | ENST00000318407 | PASK | chr2 | 242079936 | - | BOK | chr2 | 242509540 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000405260 | PASK | chr2 | 242079936 | - | ENST00000318407 | BOK | chr2 | 242509540 | + | 3127 | 1128 | 1047 | 1 | 349 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000405260 | ENST00000318407 | PASK | chr2 | 242079936 | - | BOK | chr2 | 242509540 | + | 0.48625255 | 0.51374745 |
Top |
Fusion Genomic Features for PASK-BOK |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
PASK | chr2 | 242079935 | - | BOK | chr2 | 242509539 | + | 8.57E-06 | 0.9999914 |
PASK | chr2 | 242079935 | - | BOK | chr2 | 242509539 | + | 8.57E-06 | 0.9999914 |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for PASK-BOK |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:242079936/chr2:242509540) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
. | BOK |
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. | FUNCTION: [Isoform 1]: Apoptosis regulator that functions through different apoptotic signaling pathways (PubMed:27076518, PubMed:15102863, PubMed:20673843). Plays a roles as pro-apoptotic protein that positively regulates intrinsic apoptotic process in a BAX- and BAK1-dependent manner or in a BAX- and BAK1-independent manner (PubMed:27076518, PubMed:15102863). In response to endoplasmic reticulum stress promotes mitochondrial apoptosis through downstream BAX/BAK1 activation and positive regulation of PERK-mediated unfolded protein response (By similarity). Activates apoptosis independently of heterodimerization with survival-promoting BCL2 and BCL2L1 through induction of mitochondrial outer membrane permeabilization, in a BAX- and BAK1-independent manner, in response to inhibition of ERAD-proteasome degradation system, resulting in cytochrome c release (PubMed:27076518). In response to DNA damage, mediates intrinsic apoptotic process in a TP53-dependent manner (PubMed:15102863). Plays a role in granulosa cell apoptosis by CASP3 activation (PubMed:20673843). Plays a roles as anti-apoptotic protein during neuronal apoptotic process, by negatively regulating poly ADP-ribose polymerase-dependent cell death through regulation of neuronal calcium homeostasis and mitochondrial bioenergetics in response to NMDA excitation (By similarity). In addition to its role in apoptosis, may regulate trophoblast cell proliferation during the early stages of placental development, by acting on G1/S transition through regulation of CCNE1 expression (PubMed:19942931). May also play a role as an inducer of autophagy by disrupting interaction between MCL1 and BECN1 (PubMed:24113155). {ECO:0000250|UniProtKB:O35425, ECO:0000269|PubMed:15102863, ECO:0000269|PubMed:19942931, ECO:0000269|PubMed:20673843, ECO:0000269|PubMed:24113155, ECO:0000269|PubMed:27076518}.; FUNCTION: [Isoform 2]: Pro-apoptotic molecule exerting its function through the mitochondrial pathway. {ECO:0000269|PubMed:15775999}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | BOK | chr2:242079936 | chr2:242509540 | ENST00000318407 | 2 | 5 | 164_178 | 116 | 213.0 | Motif | Note=BH2 | |
Tgene | BOK | chr2:242079936 | chr2:242509540 | ENST00000318407 | 2 | 5 | 189_209 | 116 | 213.0 | Transmembrane | Helical |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000234040 | - | 3 | 18 | 119_190 | 143 | 1324.0 | Domain | PAS 1 |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000234040 | - | 3 | 18 | 335_402 | 143 | 1324.0 | Domain | PAS 2 |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000234040 | - | 3 | 18 | 999_1251 | 143 | 1324.0 | Domain | Protein kinase |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000358649 | - | 3 | 18 | 119_190 | 143 | 1331.0 | Domain | PAS 1 |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000358649 | - | 3 | 18 | 335_402 | 143 | 1331.0 | Domain | PAS 2 |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000358649 | - | 3 | 18 | 999_1251 | 143 | 1331.0 | Domain | Protein kinase |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000403638 | - | 3 | 14 | 119_190 | 143 | 1144.0 | Domain | PAS 1 |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000403638 | - | 3 | 14 | 335_402 | 143 | 1144.0 | Domain | PAS 2 |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000403638 | - | 3 | 14 | 999_1251 | 143 | 1144.0 | Domain | Protein kinase |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000405260 | - | 3 | 18 | 119_190 | 143 | 1324.0 | Domain | PAS 1 |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000405260 | - | 3 | 18 | 335_402 | 143 | 1324.0 | Domain | PAS 2 |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000405260 | - | 3 | 18 | 999_1251 | 143 | 1324.0 | Domain | Protein kinase |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000234040 | - | 3 | 18 | 1005_1013 | 143 | 1324.0 | Nucleotide binding | Note=ATP |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000234040 | - | 3 | 18 | 1082_1089 | 143 | 1324.0 | Nucleotide binding | Note=ATP |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000358649 | - | 3 | 18 | 1005_1013 | 143 | 1331.0 | Nucleotide binding | Note=ATP |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000358649 | - | 3 | 18 | 1082_1089 | 143 | 1331.0 | Nucleotide binding | Note=ATP |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000403638 | - | 3 | 14 | 1005_1013 | 143 | 1144.0 | Nucleotide binding | Note=ATP |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000403638 | - | 3 | 14 | 1082_1089 | 143 | 1144.0 | Nucleotide binding | Note=ATP |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000405260 | - | 3 | 18 | 1005_1013 | 143 | 1324.0 | Nucleotide binding | Note=ATP |
Hgene | PASK | chr2:242079936 | chr2:242509540 | ENST00000405260 | - | 3 | 18 | 1082_1089 | 143 | 1324.0 | Nucleotide binding | Note=ATP |
Tgene | BOK | chr2:242079936 | chr2:242509540 | ENST00000318407 | 2 | 5 | 112_131 | 116 | 213.0 | Motif | Note=BH1 | |
Tgene | BOK | chr2:242079936 | chr2:242509540 | ENST00000318407 | 2 | 5 | 32_44 | 116 | 213.0 | Motif | Note=BH4 | |
Tgene | BOK | chr2:242079936 | chr2:242509540 | ENST00000318407 | 2 | 5 | 66_82 | 116 | 213.0 | Motif | Note=BH3 | |
Tgene | BOK | chr2:242079936 | chr2:242509540 | ENST00000318407 | 2 | 5 | 70_78 | 116 | 213.0 | Region | Nuclear export signal |
Top |
Fusion Gene Sequence for PASK-BOK |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>62895_62895_1_PASK-BOK_PASK_chr2_242079936_ENST00000405260_BOK_chr2_242509540_ENST00000318407_length(transcript)=3127nt_BP=1128nt GAGAAGCTGGGAAGGAAAGCAGAGGGAGTCGAAGCGGGACGCACAGAGCCGTAGCTGCAGGCAGACGGAGTGGACGTCTAGGCAGAGTGG AGAGACGCCCTGGGCTTGAGAGTTGACTTATGTCACTGTCTCGACCTCGGAGGCGTGGAGGGGCCGCGGGCCAGGCGGATCTTTCCGTGG CTGCAAGGTGCGGGCCAGTCCTACGTGCATCCCTGACCTCTGCGAGCCTCGCTGGCTGCGTCTGTACAATGGGCCGAACGGCAAGAGCAA CAACATTCTCCCGGCGTCCCCGCGCGGATTTTACCCATGCGAAATGCCGCCTTCTCTTGACGCTCGGAGCAGGCGGGCAGGTGCGGGGCA CTTGCGCTGGTGGGGCCGCTAGCCAGCTGGCTGGCTCCGGGGCGCCAGCTGGGCTCCCCTTGCAAGTCGTTCCCAGCCCAGTGCGGACGC TGCAGCCTTCGTCTACCCTGCGGAGCCACCCGGCCCATGAACGAGCCGCCCCGCGTCCTCCGCCTTCAGAAAGAGGCCTCCAAGAGGCGA GCTCTGCGCTACTCACCCATTTTGATCGCGAGTCGGGAGGAAACCGCATCTGCCCGGCCCGGGGGCGGAGGCGCCCATTATTCCTTTGGC TCCTCCGAAGCGCCGTAGGGGTGTTTGTTGTTAGAGTTGGAAGCTTGGCAGTTGGCCTCCCTTCTTCCCATGGAGGACGGGGGCTTAACA GCCTTTGAAGAGGACCAGAGATGCCTTTCCCAGAGCCTCCCCTTGCCAGTGTCAGCAGAGGGCCCAGCTGCACAGACCACTGCTGAGCCC AGCAGGTCGTTTTCCTCAGCCCACAGACACCTGAGCAGAAGGAATGGGCTTTCCAGACTCTGCCAGAGCAGGACAGCGCTCTCTGAAGAC AGATGGAGCTCCTATTGTCTATCATCACTGGCTGCCCAGAATATTTGTACAAGTAAACTGCACTGCCCTGCTGCCCCTGAGCACACGGAC CCGTCCGAACCGCGGGGCAGTGTGTCCTGCTGCTCCCTGCTGCGGGGACTGTCCTCAGGGTGGTCCTCACCTCTGCTTCCGGCCCCTGTG TGCAACCCTAACAAGGCCATCTTCACGGTGGATGCCAAGACCACAGAGGCATCACGTGGGGCAAGGTGGTGTCCCTGTATGCGGTGGCCG CGGGGCTGGCCGTGGACTGTGTGAGGCAGGCCCAGCCTGCCATGGTCCACGCCCTCGTGGACTGCCTGGGGGAGTTCGTGCGCAAGACCC TGGCAACCTGGCTGCGGAGACGCGGCGGATGGACTGATGTCCTCAAGTGTGTGGTCAGCACAGACCCTGGCCTCCGCTCCCACTGGCTGG TGGCTGCACTCTGCAGCTTCGGCCGCTTCCTGAAGGCTGCCTTCTTCGTGCTGCTGCCAGAGAGATGAGCTGCCCACCTGGCAGTGGCCG CAGCCTGGCCCTCTGGGCCCAACGCAGGAGGCCCTCAGCACCCGAACACATCTTCCTCCTCCCCACCCGAGCCTGGAGCACTCTAACCCT CGGAGACCCCCTAAGCCCCGTTCCTCCGCAGACCCAGGCCCTCCGGAAGGGGTGAGTGGGGAGGGGCTTTCCTGAGCCTGGAGCTGGGCT TTGGGGCAGCCTGCGACCCTCCCCGCTTGTGTCCCTTCTCCTGTGATCTCTGTGTTTTCCCTTTTCTTTCTGGGGCCAGGAAGTCAGGGT CAACTCCCAGGCCTCAGATGCAGGGGCCCAGAACACCTGCTCTCACCTGAGCCCCAGGTGAAGGGGCCCGGGAACACCTGCTCTCACCTG AGCCCCAGGTGAAGGGGCCCGGGAACACCTGCTCTCACCTGAACCCCAGGTGAAGGGGCCCGGAACACCTGCTCTCACCTGAGCCCCAGG TGAAGGGGCCCGGAACACCTGCTCTCACCTGAGCCCCAGGTGAAGGGGCCCGGGAACACCTGCTCTCACCTGAGCCCCAGGTGAAGGGGC CCGGGAACACCTGCTCTCACCTGAACCCCAGGTGAAGGGGCCCAGAACACCTGCTCTCACCTGAGCCCCAGGTGAAGGGGCCCGGAACAC CTGCTCTCACCTGAGCCCCAGGTGAAGGGGCCCGGGAACACCTGCTCTCACCTGAGCCCCTGGTGAAGGGGCCCGGAACACTTGCTCTCA CCTGAGCCCCAGGTGAAGGGGCCCGGAACACCTGCTCTCACCTGAGCCCCCGGTGAAGGGGCCCGGAACACTTGCTCTCACCTGAGCCCC AGGTGAAGGGGCCCGGAACACCTCCTCTCACCTGAGCCCCAGGTGAAGGGGCCCGGAACACCTCCTGTCACCTGAGCCCCAGGTGAAGGG GCCCGGGAACACCTCTCACCTGAACCCGGGGGTCCCATCCCAGGAAGAAGGGCCATCTCAGGACATGAGTCCTCAGGGGCCCTGCACATT CAATCTGAAGGTGACCCTGGCCTGGCTGAAGCTGGAAGAGCTGTGGGGACTCAGCCTGTAAACAGAGCGTAAGGTTCACATGCTGGTTGC TTAATCCGTTTCTGGAGGAAGAGTATGACACCCACTTGTGATGGGGTCCTTGTGCGGTGGGGACCGGGGCCGGCGGGCTCCAGGCCAGCA CACCTAACCCATGGATGTGGAACCTACGGCCGAGAAGGAATGTTGCATGAGTCGGATCCCAGTCCATTGTCAGTGGAGGGTGAGGGTGAC CCCATCTGCTATTTTTGTGCTCATCCTCATACAACCATTTGGGGATGTGCCTATTAGGGCTCCGTAAGAACTCAGATGCCTGGGAAGCCC AGCCCCTCAGGTGCCCCCACACACAGCCTTCCCTTGACGCCTACATTTCTAGGCACATGTGAGGCATCTTTCCTGGAGCCCCGAGCCAGC CCTGTCCCTCCCCAGTGCAGCATGGCACTCAGGAGATACAGGCTGGACATGGGGCAGTCGTTCTGGGGAGGCCTGGCCTAGCAGCCACCC ACCTGAGCCCTCCCGGCCAGGCTTCGTGCTGGGGTGGGCCATGTGCCAGGACAGGAGGGTCCCGGCGGAAAGCCAGCCCCGGACTCATCG >62895_62895_1_PASK-BOK_PASK_chr2_242079936_ENST00000405260_BOK_chr2_242509540_ENST00000318407_length(amino acids)=349AA_BP= MRTVPAAGSSRTHCPAVRTGPCAQGQQGSAVYLYKYSGQPVMIDNRSSICLQRALSCSGRVWKAHSFCSGVCGLRKTTCWAQQWSVQLGP LLTLARGGSGKGISGPLQRLLSPRPPWEEGRPTAKLPTLTTNTPTALRRSQRNNGRLRPRAGQMRFPPDSRSKWVSSAELASWRPLSEGG GRGAARSWAGWLRRVDEGCSVRTGLGTTCKGSPAGAPEPASWLAAPPAQVPRTCPPAPSVKRRRHFAWVKSARGRRENVVALAVRPIVQT -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for PASK-BOK |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for PASK-BOK |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for PASK-BOK |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |