|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:ARL5A-IL1B (FusionGDB2 ID:6610) |
Fusion Gene Summary for ARL5A-IL1B |
Fusion gene summary |
Fusion gene information | Fusion gene name: ARL5A-IL1B | Fusion gene ID: 6610 | Hgene | Tgene | Gene symbol | ARL5A | IL1B | Gene ID | 26225 | 3553 |
Gene name | ADP ribosylation factor like GTPase 5A | interleukin 1 beta | |
Synonyms | ARFLP5|ARL5 | IL-1|IL1-BETA|IL1F2|IL1beta | |
Cytomap | 2q23.3 | 2q14.1 | |
Type of gene | protein-coding | protein-coding | |
Description | ADP-ribosylation factor-like protein 5AADP-ribosylation factor-like 5ADP-ribosylation factor-like 5AADP-ribosylation factor-like protein 5 | interleukin-1 betaIL-1 betacatabolininterleukin 1betapreinterleukin 1 betapro-interleukin-1-beta | |
Modification date | 20200313 | 20200329 | |
UniProtAcc | Q9Y689 | P01584 | |
Ensembl transtripts involved in fusion gene | ENST00000295087, ENST00000428992, ENST00000487723, | ENST00000263341, ENST00000491056, | |
Fusion gene scores | * DoF score | 4 X 6 X 4=96 | 4 X 6 X 3=72 |
# samples | 5 | 6 | |
** MAII score | log2(5/96*10)=-0.941106310946431 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/72*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: ARL5A [Title/Abstract] AND IL1B [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | ARL5A(152668871)-IL1B(113593821), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | ARL5A-IL1B seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | IL1B | GO:0000187 | activation of MAPK activity | 10748004 |
Tgene | IL1B | GO:0001934 | positive regulation of protein phosphorylation | 10748004 |
Tgene | IL1B | GO:0006954 | inflammatory response | 10748004|21147091 |
Tgene | IL1B | GO:0008284 | positive regulation of cell proliferation | 25204733 |
Tgene | IL1B | GO:0008285 | negative regulation of cell proliferation | 3493774 |
Tgene | IL1B | GO:0010575 | positive regulation of vascular endothelial growth factor production | 12958148 |
Tgene | IL1B | GO:0010628 | positive regulation of gene expression | 11090614|21559518|23817958|25327529|26687115|29384235 |
Tgene | IL1B | GO:0010718 | positive regulation of epithelial to mesenchymal transition | 25204733 |
Tgene | IL1B | GO:0019221 | cytokine-mediated signaling pathway | 10748004 |
Tgene | IL1B | GO:0030213 | hyaluronan biosynthetic process | 15100360 |
Tgene | IL1B | GO:0030335 | positive regulation of cell migration | 25204733 |
Tgene | IL1B | GO:0030730 | sequestering of triglyceride | 19032770 |
Tgene | IL1B | GO:0031663 | lipopolysaccharide-mediated signaling pathway | 21147091 |
Tgene | IL1B | GO:0032496 | response to lipopolysaccharide | 19193853 |
Tgene | IL1B | GO:0032725 | positive regulation of granulocyte macrophage colony-stimulating factor production | 20027291 |
Tgene | IL1B | GO:0032729 | positive regulation of interferon-gamma production | 10653850|20027291 |
Tgene | IL1B | GO:0032757 | positive regulation of interleukin-8 production | 19524870 |
Tgene | IL1B | GO:0034116 | positive regulation of heterotypic cell-cell adhesion | 15100360 |
Tgene | IL1B | GO:0035505 | positive regulation of myosin light chain kinase activity | 18390750 |
Tgene | IL1B | GO:0035690 | cellular response to drug | 19158679 |
Tgene | IL1B | GO:0042102 | positive regulation of T cell proliferation | 1919436 |
Tgene | IL1B | GO:0043122 | regulation of I-kappaB kinase/NF-kappaB signaling | 10748004 |
Tgene | IL1B | GO:0045429 | positive regulation of nitric oxide biosynthetic process | 8383325 |
Tgene | IL1B | GO:0045766 | positive regulation of angiogenesis | 25204733 |
Tgene | IL1B | GO:0045893 | positive regulation of transcription, DNA-templated | 15100360 |
Tgene | IL1B | GO:0050796 | regulation of insulin secretion | 8383325 |
Tgene | IL1B | GO:0050995 | negative regulation of lipid catabolic process | 19032770 |
Tgene | IL1B | GO:0050999 | regulation of nitric-oxide synthase activity | 15899045 |
Tgene | IL1B | GO:0051044 | positive regulation of membrane protein ectodomain proteolysis | 18373975 |
Tgene | IL1B | GO:0051091 | positive regulation of DNA-binding transcription factor activity | 10748004 |
Tgene | IL1B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity | 10383454|12958148|25327529 |
Tgene | IL1B | GO:0060559 | positive regulation of calcidiol 1-monooxygenase activity | 16720713|17023519 |
Tgene | IL1B | GO:0070372 | regulation of ERK1 and ERK2 cascade | 25204733 |
Tgene | IL1B | GO:0070487 | monocyte aggregation | 15100360 |
Tgene | IL1B | GO:0070498 | interleukin-1-mediated signaling pathway | 25327529 |
Tgene | IL1B | GO:0070555 | response to interleukin-1 | 29441883 |
Tgene | IL1B | GO:0071310 | cellular response to organic substance | 19158679 |
Tgene | IL1B | GO:0071407 | cellular response to organic cyclic compound | 21147091 |
Tgene | IL1B | GO:0071639 | positive regulation of monocyte chemotactic protein-1 production | 19524870 |
Tgene | IL1B | GO:1901224 | positive regulation of NIK/NF-kappaB signaling | 18390750 |
Tgene | IL1B | GO:1902680 | positive regulation of RNA biosynthetic process | 29384235 |
Tgene | IL1B | GO:1903140 | regulation of establishment of endothelial barrier | 25816133 |
Tgene | IL1B | GO:1903597 | negative regulation of gap junction assembly | 11090614 |
Tgene | IL1B | GO:2000556 | positive regulation of T-helper 1 cell cytokine production | 10653850 |
Tgene | IL1B | GO:2001240 | negative regulation of extrinsic apoptotic signaling pathway in absence of ligand | 10748004 |
Fusion gene breakpoints across ARL5A (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across IL1B (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-CD-8524-01A | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113591152 | - |
ChimerDB4 | STAD | TCGA-CD-8524-01A | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113593821 | - |
ChimerDB4 | STAD | TCGA-CD-8524-01A | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113594435 | - |
ChimerDB4 | STAD | TCGA-CD-8524-01A | ARL5A | chr2 | 152670683 | - | IL1B | chr2 | 113593821 | - |
ChimerDB4 | STAD | TCGA-CD-8524 | ARL5A | chr2 | 152668870 | - | IL1B | chr2 | 113593821 | - |
Top |
Fusion Gene ORF analysis for ARL5A-IL1B |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-5UTR | ENST00000295087 | ENST00000263341 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113593821 | - |
5CDS-5UTR | ENST00000295087 | ENST00000263341 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113594435 | - |
5CDS-5UTR | ENST00000295087 | ENST00000263341 | ARL5A | chr2 | 152670683 | - | IL1B | chr2 | 113593821 | - |
5CDS-5UTR | ENST00000295087 | ENST00000263341 | ARL5A | chr2 | 152668870 | - | IL1B | chr2 | 113593821 | - |
5CDS-5UTR | ENST00000295087 | ENST00000491056 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113591152 | - |
5CDS-5UTR | ENST00000295087 | ENST00000491056 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113593821 | - |
5CDS-5UTR | ENST00000295087 | ENST00000491056 | ARL5A | chr2 | 152670683 | - | IL1B | chr2 | 113593821 | - |
5CDS-5UTR | ENST00000295087 | ENST00000491056 | ARL5A | chr2 | 152668870 | - | IL1B | chr2 | 113593821 | - |
5CDS-5UTR | ENST00000428992 | ENST00000263341 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113593821 | - |
5CDS-5UTR | ENST00000428992 | ENST00000263341 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113594435 | - |
5CDS-5UTR | ENST00000428992 | ENST00000263341 | ARL5A | chr2 | 152670683 | - | IL1B | chr2 | 113593821 | - |
5CDS-5UTR | ENST00000428992 | ENST00000263341 | ARL5A | chr2 | 152668870 | - | IL1B | chr2 | 113593821 | - |
5CDS-5UTR | ENST00000428992 | ENST00000491056 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113591152 | - |
5CDS-5UTR | ENST00000428992 | ENST00000491056 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113593821 | - |
5CDS-5UTR | ENST00000428992 | ENST00000491056 | ARL5A | chr2 | 152670683 | - | IL1B | chr2 | 113593821 | - |
5CDS-5UTR | ENST00000428992 | ENST00000491056 | ARL5A | chr2 | 152668870 | - | IL1B | chr2 | 113593821 | - |
5CDS-intron | ENST00000295087 | ENST00000491056 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113594435 | - |
5CDS-intron | ENST00000428992 | ENST00000491056 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113594435 | - |
Frame-shift | ENST00000428992 | ENST00000263341 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113591152 | - |
In-frame | ENST00000295087 | ENST00000263341 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113591152 | - |
intron-3CDS | ENST00000487723 | ENST00000263341 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113591152 | - |
intron-5UTR | ENST00000487723 | ENST00000263341 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113593821 | - |
intron-5UTR | ENST00000487723 | ENST00000263341 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113594435 | - |
intron-5UTR | ENST00000487723 | ENST00000263341 | ARL5A | chr2 | 152670683 | - | IL1B | chr2 | 113593821 | - |
intron-5UTR | ENST00000487723 | ENST00000263341 | ARL5A | chr2 | 152668870 | - | IL1B | chr2 | 113593821 | - |
intron-5UTR | ENST00000487723 | ENST00000491056 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113591152 | - |
intron-5UTR | ENST00000487723 | ENST00000491056 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113593821 | - |
intron-5UTR | ENST00000487723 | ENST00000491056 | ARL5A | chr2 | 152670683 | - | IL1B | chr2 | 113593821 | - |
intron-5UTR | ENST00000487723 | ENST00000491056 | ARL5A | chr2 | 152668870 | - | IL1B | chr2 | 113593821 | - |
intron-intron | ENST00000487723 | ENST00000491056 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113594435 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000295087 | ARL5A | chr2 | 152668871 | - | ENST00000263341 | IL1B | chr2 | 113591152 | - | 1972 | 651 | 129 | 1361 | 410 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000295087 | ENST00000263341 | ARL5A | chr2 | 152668871 | - | IL1B | chr2 | 113591152 | - | 0.000908222 | 0.99909174 |
Top |
Fusion Genomic Features for ARL5A-IL1B |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for ARL5A-IL1B |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:152668871/chr2:113593821) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
ARL5A | IL1B |
FUNCTION: Lacks ADP-ribosylation enhancing activity. {ECO:0000250}. | FUNCTION: Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells (PubMed:10653850). Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6 (PubMed:12794819). {ECO:0000269|PubMed:10653850, ECO:0000269|PubMed:12794819, ECO:0000269|PubMed:3920526}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ARL5A | chr2:152668871 | chr2:113591152 | ENST00000295087 | - | 4 | 6 | 23_30 | 113 | 180.0 | Nucleotide binding | Note=GTP |
Hgene | ARL5A | chr2:152668871 | chr2:113591152 | ENST00000295087 | - | 4 | 6 | 66_70 | 113 | 180.0 | Nucleotide binding | GTP |
Hgene | ARL5A | chr2:152668871 | chr2:113591152 | ENST00000428992 | - | 4 | 6 | 23_30 | 76 | 143.0 | Nucleotide binding | Note=GTP |
Hgene | ARL5A | chr2:152668871 | chr2:113591152 | ENST00000428992 | - | 4 | 6 | 66_70 | 76 | 143.0 | Nucleotide binding | GTP |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ARL5A | chr2:152668871 | chr2:113591152 | ENST00000295087 | - | 4 | 6 | 125_128 | 113 | 180.0 | Nucleotide binding | Note=GTP |
Hgene | ARL5A | chr2:152668871 | chr2:113591152 | ENST00000428992 | - | 4 | 6 | 125_128 | 76 | 143.0 | Nucleotide binding | Note=GTP |
Top |
Fusion Gene Sequence for ARL5A-IL1B |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>6610_6610_1_ARL5A-IL1B_ARL5A_chr2_152668871_ENST00000295087_IL1B_chr2_113591152_ENST00000263341_length(transcript)=1972nt_BP=651nt GCGTGGTCGTCGCCACCGCAGCCGCCCGAGAGGAGCTGGGGGAGGACGGTGGCCCGCGAGGCTCGTCGCAGACAACGCGGCGGCGATGTC CGCGAGCCAGGCGAGTGCCGCGGCGGCAGCGGCGGGGCCTTGCGCGCGGCAGGGCGGCCTGGGCTTCGGCCTCCCTCCGGTTCCCTGGAA GCGGGCCCGCGACCAGCGCGGGAGCAGCAGCAGAGGCGGAGGCTCCAGCGCGTCTCTCTCCTCCCCCTCAGCCTGAGCCGGGGGAAGCCA GGCGGCCCGGGTGTCTGGAGGGGGGGGGTCCGCTGCCCGAGAATGGGAATTCTCTTCACTAGAATATGGAGACTGTTCAATCACCAGGAG CACAAAGTTATCATTGTTGGGCTGGATAATGCAGGGAAAACTACCATTCTTTACCAATTTTCTATGAATGAAGTTGTACATACATCTCCT ACAATAGGAAGTAATGTAGAAGAGATAGTGATTAATAATACACGTTTCCTAATGTGGGATATTGGTGGCCAAGAATCTCTTCGTTCTTCC TGGAACACTTACTATACTAACACAGAGTTTGTAATAGTTGTTGTGGACAGTACAGACAGAGAGAGGATTTCTGTAACTAGAGAAGAACTC TATAAAATGTTAGCGCATGAGTGCTCCTTCCAGGACCTGGACCTCTGCCCTCTGGATGGCGGCATCCAGCTACGAATCTCCGACCACCAC TACAGCAAGGGCTTCAGGCAGGCCGCGTCAGTTGTTGTGGCCATGGACAAGCTGAGGAAGATGCTGGTTCCCTGCCCACAGACCTTCCAG GAGAATGACCTGAGCACCTTCTTTCCCTTCATCTTTGAAGAAGAACCTATCTTCTTCGACACATGGGATAACGAGGCTTATGTGCACGAT GCACCTGTACGATCACTGAACTGCACGCTCCGGGACTCACAGCAAAAAAGCTTGGTGATGTCTGGTCCATATGAACTGAAAGCTCTCCAC CTCCAGGGACAGGATATGGAGCAACAAGTGGTGTTCTCCATGTCCTTTGTACAAGGAGAAGAAAGTAATGACAAAATACCTGTGGCCTTG GGCCTCAAGGAAAAGAATCTGTACCTGTCCTGCGTGTTGAAAGATGATAAGCCCACTCTACAGCTGGAGAGTGTAGATCCCAAAAATTAC CCAAAGAAGAAGATGGAAAAGCGATTTGTCTTCAACAAGATAGAAATCAATAACAAGCTGGAATTTGAGTCTGCCCAGTTCCCCAACTGG TACATCAGCACCTCTCAAGCAGAAAACATGCCCGTCTTCCTGGGAGGGACCAAAGGCGGCCAGGATATAACTGACTTCACCATGCAATTT GTGTCTTCCTAAAGAGAGCTGTACCCAGAGAGTCCTGTGCTGAATGTGGACTCAATCCCTAGGGCTGGCAGAAAGGGAACAGAAAGGTTT TTGAGTACGGCTATAGCCTGGACTTTCCTGTTGTCTACACCAATGCCCAACTGCCTGCCTTAGGGTAGTGCTAAGAGGATCTCCTGTCCA TCAGCCAGGACAGTCAGCTCTCTCCTTTCAGGGCCAATCCCCAGCCCTTTTGTTGAGCCAGGCCTCTCTCACCTCTCCTACTCACTTAAA GCCCGCCTGACAGAAACCACGGCCACATTTGGTTCTAAGAAACCCTCTGTCATTCGCTCCCACATTCTGATGAGCAACCGCTTCCCTATT TATTTATTTATTTGTTTGTTTGTTTTATTCATTGGTCTAATTTATTCAAAGGGGGCAAGAAGTAGCAGTGTCTGTAAAAGAGCCTAGTTT TTAATAGCTATGGAATCAATTCAATTTGGACTGGTGTGCTCTCTTTAAATCAAGTCCTTTAATTAAGACTGAAAATATATAAGCTCAGAT >6610_6610_1_ARL5A-IL1B_ARL5A_chr2_152668871_ENST00000295087_IL1B_chr2_113591152_ENST00000263341_length(amino acids)=410AA_BP=174 MRAAGRPGLRPPSGSLEAGPRPAREQQQRRRLQRVSLLPLSLSRGKPGGPGVWRGGVRCPRMGILFTRIWRLFNHQEHKVIIVGLDNAGK TTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHECSFQDL DLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDS QQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNK -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ARL5A-IL1B |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ARL5A-IL1B |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for ARL5A-IL1B |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |