|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:SEMA3C-CD36 (FusionGDB2 ID:80278) |
Fusion Gene Summary for SEMA3C-CD36 |
Fusion gene summary |
Fusion gene information | Fusion gene name: SEMA3C-CD36 | Fusion gene ID: 80278 | Hgene | Tgene | Gene symbol | SEMA3C | CD36 | Gene ID | 10512 | 948 |
Gene name | semaphorin 3C | CD36 molecule | |
Synonyms | SEMAE|SemE | BDPLT10|CHDS7|FAT|GP3B|GP4|GPIV|PASIV|SCARB3 | |
Cytomap | 7q21.11 | 7q21.11 | |
Type of gene | protein-coding | protein-coding | |
Description | semaphorin-3Csema Esema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Csemaphorin E | platelet glycoprotein 4CD36 antigen (collagen type I receptor, thrombospondin receptor)CD36 molecule (thrombospondin receptor)GPIIIBPAS IVPAS-4 proteincluster determinant 36fatty acid translocaseglycoprotein IIIbleukocyte differentiation antigen | |
Modification date | 20200313 | 20200322 | |
UniProtAcc | . | P16671 | |
Ensembl transtripts involved in fusion gene | ENST00000265361, ENST00000419255, ENST00000536800, ENST00000544525, ENST00000487621, | ENST00000435819, ENST00000309881, ENST00000394788, ENST00000432207, ENST00000433696, ENST00000441109, ENST00000447544, ENST00000534394, ENST00000538969, ENST00000544133, | |
Fusion gene scores | * DoF score | 7 X 5 X 5=175 | 5 X 6 X 4=120 |
# samples | 8 | 6 | |
** MAII score | log2(8/175*10)=-1.12928301694497 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/120*10)=-1 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: SEMA3C [Title/Abstract] AND CD36 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | SEMA3C(80545995)-CD36(80115783), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | SEMA3C-CD36 seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. SEMA3C-CD36 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | CD36 | GO:0001954 | positive regulation of cell-matrix adhesion | 17416590 |
Tgene | CD36 | GO:0007263 | nitric oxide mediated signal transduction | 17416590 |
Tgene | CD36 | GO:0019934 | cGMP-mediated signaling | 17416590 |
Tgene | CD36 | GO:0044539 | long-chain fatty acid import | 17416590|22022213 |
Tgene | CD36 | GO:0071726 | cellular response to diacyl bacterial lipopeptide | 16880211 |
Fusion gene breakpoints across SEMA3C (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across CD36 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BLCA | TCGA-GV-A3QF-01A | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
ChimerDB4 | LUSC | TCGA-22-5492-01A | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
Top |
Fusion Gene ORF analysis for SEMA3C-CD36 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-5UTR | ENST00000265361 | ENST00000435819 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-5UTR | ENST00000419255 | ENST00000435819 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-5UTR | ENST00000536800 | ENST00000435819 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-5UTR | ENST00000544525 | ENST00000435819 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000265361 | ENST00000309881 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000265361 | ENST00000394788 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000265361 | ENST00000394788 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000265361 | ENST00000432207 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000265361 | ENST00000432207 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000265361 | ENST00000433696 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000265361 | ENST00000433696 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000265361 | ENST00000441109 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000265361 | ENST00000441109 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000265361 | ENST00000447544 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000265361 | ENST00000447544 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000265361 | ENST00000534394 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000265361 | ENST00000538969 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000265361 | ENST00000538969 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000265361 | ENST00000544133 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000265361 | ENST00000544133 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000419255 | ENST00000309881 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000419255 | ENST00000394788 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000419255 | ENST00000394788 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000419255 | ENST00000432207 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000419255 | ENST00000432207 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000419255 | ENST00000433696 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000419255 | ENST00000433696 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000419255 | ENST00000441109 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000419255 | ENST00000441109 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000419255 | ENST00000447544 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000419255 | ENST00000447544 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000419255 | ENST00000534394 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000419255 | ENST00000538969 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000419255 | ENST00000538969 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000419255 | ENST00000544133 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000419255 | ENST00000544133 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000536800 | ENST00000309881 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000536800 | ENST00000394788 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000536800 | ENST00000394788 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000536800 | ENST00000432207 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000536800 | ENST00000432207 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000536800 | ENST00000433696 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000536800 | ENST00000433696 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000536800 | ENST00000441109 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000536800 | ENST00000441109 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000536800 | ENST00000447544 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000536800 | ENST00000447544 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000536800 | ENST00000534394 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000536800 | ENST00000538969 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000536800 | ENST00000538969 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000536800 | ENST00000544133 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000536800 | ENST00000544133 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000544525 | ENST00000309881 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000544525 | ENST00000394788 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000544525 | ENST00000394788 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000544525 | ENST00000432207 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000544525 | ENST00000432207 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000544525 | ENST00000433696 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000544525 | ENST00000433696 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000544525 | ENST00000441109 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000544525 | ENST00000441109 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000544525 | ENST00000447544 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000544525 | ENST00000447544 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000544525 | ENST00000534394 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000544525 | ENST00000538969 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000544525 | ENST00000538969 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5CDS-intron | ENST00000544525 | ENST00000544133 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5CDS-intron | ENST00000544525 | ENST00000544133 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5UTR-3CDS | ENST00000487621 | ENST00000309881 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5UTR-3CDS | ENST00000487621 | ENST00000435819 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5UTR-3CDS | ENST00000487621 | ENST00000534394 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5UTR-5UTR | ENST00000487621 | ENST00000435819 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5UTR-intron | ENST00000487621 | ENST00000309881 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5UTR-intron | ENST00000487621 | ENST00000394788 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5UTR-intron | ENST00000487621 | ENST00000394788 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5UTR-intron | ENST00000487621 | ENST00000432207 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5UTR-intron | ENST00000487621 | ENST00000432207 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5UTR-intron | ENST00000487621 | ENST00000433696 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5UTR-intron | ENST00000487621 | ENST00000433696 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5UTR-intron | ENST00000487621 | ENST00000441109 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5UTR-intron | ENST00000487621 | ENST00000441109 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5UTR-intron | ENST00000487621 | ENST00000447544 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5UTR-intron | ENST00000487621 | ENST00000447544 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5UTR-intron | ENST00000487621 | ENST00000534394 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5UTR-intron | ENST00000487621 | ENST00000538969 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5UTR-intron | ENST00000487621 | ENST00000538969 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
5UTR-intron | ENST00000487621 | ENST00000544133 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
5UTR-intron | ENST00000487621 | ENST00000544133 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80115783 | + |
Frame-shift | ENST00000419255 | ENST00000309881 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
Frame-shift | ENST00000419255 | ENST00000435819 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
Frame-shift | ENST00000419255 | ENST00000534394 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
Frame-shift | ENST00000536800 | ENST00000309881 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
Frame-shift | ENST00000536800 | ENST00000435819 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
Frame-shift | ENST00000536800 | ENST00000534394 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
Frame-shift | ENST00000544525 | ENST00000309881 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
Frame-shift | ENST00000544525 | ENST00000435819 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
Frame-shift | ENST00000544525 | ENST00000534394 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
In-frame | ENST00000265361 | ENST00000309881 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
In-frame | ENST00000265361 | ENST00000435819 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
In-frame | ENST00000265361 | ENST00000534394 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000265361 | SEMA3C | chr7 | 80545995 | - | ENST00000435819 | CD36 | chr7 | 80293722 | + | 1737 | 665 | 659 | 1474 | 271 |
ENST00000265361 | SEMA3C | chr7 | 80545995 | - | ENST00000309881 | CD36 | chr7 | 80293722 | + | 1737 | 665 | 659 | 1474 | 271 |
ENST00000265361 | SEMA3C | chr7 | 80545995 | - | ENST00000534394 | CD36 | chr7 | 80293722 | + | 1744 | 665 | 659 | 1474 | 271 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000265361 | ENST00000435819 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + | 0.000969141 | 0.9990308 |
ENST00000265361 | ENST00000309881 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + | 0.000969141 | 0.9990308 |
ENST00000265361 | ENST00000534394 | SEMA3C | chr7 | 80545995 | - | CD36 | chr7 | 80293722 | + | 0.000955787 | 0.99904424 |
Top |
Fusion Genomic Features for SEMA3C-CD36 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
SEMA3C | chr7 | 80545994 | - | CD36 | chr7 | 80115782 | + | 0.080391265 | 0.9196087 |
SEMA3C | chr7 | 80545994 | - | CD36 | chr7 | 80293721 | + | 0.03875456 | 0.9612454 |
SEMA3C | chr7 | 80545994 | - | CD36 | chr7 | 80115782 | + | 0.080391265 | 0.9196087 |
SEMA3C | chr7 | 80545994 | - | CD36 | chr7 | 80293721 | + | 0.03875456 | 0.9612454 |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for SEMA3C-CD36 |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:80545995/chr7:80115783) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
. | CD36 |
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. | FUNCTION: Multifunctional glycoprotein that acts as receptor for a broad range of ligands. Ligands can be of proteinaceous nature like thrombospondin, fibronectin, collagen or amyloid-beta as well as of lipidic nature such as oxidized low-density lipoprotein (oxLDL), anionic phospholipids, long-chain fatty acids and bacterial diacylated lipopeptides. They are generally multivalent and can therefore engage multiple receptors simultaneously, the resulting formation of CD36 clusters initiates signal transduction and internalization of receptor-ligand complexes. The dependency on coreceptor signaling is strongly ligand specific. Cellular responses to these ligands are involved in angiogenesis, inflammatory response, fatty acid metabolism, taste and dietary fat processing in the intestine (Probable). Binds long-chain fatty acids and facilitates their transport into cells, thus participating in muscle lipid utilization, adipose energy storage, and gut fat absorption (By similarity) (PubMed:18353783, PubMed:21610069). In the small intestine, plays a role in proximal absorption of dietary fatty acid and cholesterol for optimal chylomicron formation, possibly through the activation of MAPK1/3 (ERK1/2) signaling pathway (By similarity) (PubMed:18753675). Involved in oral fat perception and preferences (PubMed:22240721, PubMed:25822988). Detection into the tongue of long-chain fatty acids leads to a rapid and sustained rise in flux and protein content of pancreatobiliary secretions (By similarity). In taste receptor cells, mediates the induction of an increase in intracellular calcium levels by long-chain fatty acids, leading to the activation of the gustatory neurons in the nucleus of the solitary tract (By similarity). Important factor in both ventromedial hypothalamus neuronal sensing of long-chain fatty acid and the regulation of energy and glucose homeostasis (By similarity). Receptor for thombospondins, THBS1 and THBS2, mediating their antiangiogenic effects (By similarity). As a coreceptor for TLR4:TLR6 heterodimer, promotes inflammation in monocytes/macrophages. Upon ligand binding, such as oxLDL or amyloid-beta 42, interacts with the heterodimer TLR4:TLR6, the complex is internalized and triggers inflammatory response, leading to NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion, through the priming and activation of the NLRP3 inflammasome (By similarity) (PubMed:20037584). Selective and nonredundant sensor of microbial diacylated lipopeptide that signal via TLR2:TLR6 heterodimer, this cluster triggers signaling from the cell surface, leading to the NF-kappa-B-dependent production of TNF, via MYD88 signaling pathway and subsequently is targeted to the Golgi in a lipid-raft dependent pathway (By similarity) (PubMed:16880211). {ECO:0000250|UniProtKB:Q07969, ECO:0000250|UniProtKB:Q08857, ECO:0000269|PubMed:16880211, ECO:0000269|PubMed:18353783, ECO:0000269|PubMed:18753675, ECO:0000269|PubMed:20037584, ECO:0000269|PubMed:21395585, ECO:0000269|PubMed:21610069, ECO:0000269|PubMed:22240721, ECO:0000269|PubMed:25822988, ECO:0000305|PubMed:19471024}.; FUNCTION: (Microbial infection) Directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and the internalization of particles independently of TLR signaling. {ECO:0000269|PubMed:10890433, ECO:0000269|PubMed:12506336, ECO:0000269|PubMed:19864601}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000309881 | 5 | 14 | 440_461 | 203 | 473.0 | Transmembrane | Helical | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000394788 | 5 | 14 | 440_461 | 203 | 473.0 | Transmembrane | Helical | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000432207 | 4 | 13 | 440_461 | 203 | 473.0 | Transmembrane | Helical | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000435819 | 8 | 17 | 440_461 | 203 | 473.0 | Transmembrane | Helical | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000447544 | 5 | 15 | 440_461 | 203 | 657.6666666666666 | Transmembrane | Helical |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | SEMA3C | chr7:80545995 | chr7:80293722 | ENST00000265361 | - | 2 | 18 | 724_745 | 34 | 752.0 | Compositional bias | Note=Arg/Lys-rich (basic) |
Hgene | SEMA3C | chr7:80545995 | chr7:80293722 | ENST00000419255 | - | 2 | 18 | 724_745 | 34 | 752.0 | Compositional bias | Note=Arg/Lys-rich (basic) |
Hgene | SEMA3C | chr7:80545995 | chr7:80293722 | ENST00000265361 | - | 2 | 18 | 28_511 | 34 | 752.0 | Domain | Sema |
Hgene | SEMA3C | chr7:80545995 | chr7:80293722 | ENST00000265361 | - | 2 | 18 | 571_655 | 34 | 752.0 | Domain | Note=Ig-like C2-type |
Hgene | SEMA3C | chr7:80545995 | chr7:80293722 | ENST00000419255 | - | 2 | 18 | 28_511 | 34 | 752.0 | Domain | Sema |
Hgene | SEMA3C | chr7:80545995 | chr7:80293722 | ENST00000419255 | - | 2 | 18 | 571_655 | 34 | 752.0 | Domain | Note=Ig-like C2-type |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000309881 | 5 | 14 | 2_7 | 203 | 473.0 | Topological domain | Cytoplasmic | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000309881 | 5 | 14 | 30_439 | 203 | 473.0 | Topological domain | Extracellular | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000394788 | 5 | 14 | 2_7 | 203 | 473.0 | Topological domain | Cytoplasmic | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000394788 | 5 | 14 | 30_439 | 203 | 473.0 | Topological domain | Extracellular | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000432207 | 4 | 13 | 2_7 | 203 | 473.0 | Topological domain | Cytoplasmic | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000432207 | 4 | 13 | 30_439 | 203 | 473.0 | Topological domain | Extracellular | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000435819 | 8 | 17 | 2_7 | 203 | 473.0 | Topological domain | Cytoplasmic | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000435819 | 8 | 17 | 30_439 | 203 | 473.0 | Topological domain | Extracellular | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000447544 | 5 | 15 | 2_7 | 203 | 657.6666666666666 | Topological domain | Cytoplasmic | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000447544 | 5 | 15 | 30_439 | 203 | 657.6666666666666 | Topological domain | Extracellular | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000309881 | 5 | 14 | 8_29 | 203 | 473.0 | Transmembrane | Helical | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000394788 | 5 | 14 | 8_29 | 203 | 473.0 | Transmembrane | Helical | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000432207 | 4 | 13 | 8_29 | 203 | 473.0 | Transmembrane | Helical | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000435819 | 8 | 17 | 8_29 | 203 | 473.0 | Transmembrane | Helical | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000447544 | 5 | 15 | 8_29 | 203 | 657.6666666666666 | Transmembrane | Helical |
Top |
Fusion Gene Sequence for SEMA3C-CD36 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>80278_80278_1_SEMA3C-CD36_SEMA3C_chr7_80545995_ENST00000265361_CD36_chr7_80293722_ENST00000309881_length(transcript)=1737nt_BP=665nt GGACTGCGAAAGGAGCAGGGTTGCGGAGCTAGGGCTCCAGCCTGCGGCCGCGCATTCTTGCGTCTGGCCAGCCGCGAGCTCTAAGGGTCG GCCCCGCCCGGTCCGCCCCCGCGGCTCCCTGCCAGGCTCTCGCGGGCGCGCTCGGGGTGGGGCCTCGCGGCTGGCGGAGATGCGGCCGGG GCTGCGCGGTGGTGATGCGAGCCTGCAGGGCGGCGCGCCGGGGCAGCCGGAGCCGCGCGCCGCGGCGCTGTAATCGGACACCAAGAGCGC TCGCCCCCGGCCTCCGGCCACTTTCCATTCACTCCGAGGTGCTTGATTGAGCGACGCGGAGAAGAGCTCCGGGTGCCGCGGCACTGCAGC GCTGAGATTCCTTTACAAAGAAACTCAGAGGACCGGGAAGAAAGAATTTCACCTTTGCGACGTGCTAGAAAATAAGGTCGTCTGGGAAAA GGACTGGAGACACAAGCGCATCCAACCCCGGTAGCAAACTGATGACTTTTCCGTGCTGATTTCTTTCAACCTCGGTATTTTCCCTTGGAT ATTAACTTGCATATCTGAAGAAATGGCATTCCGGACAATTTGCGTGTTGGTTGGAGTATTTATTTGTTCTATCTGTGTGAAAGGATCTTC CCAGCCCCAAGCAAGAGTTTATTTAACATTTGATGTACAACAATACTGCAGATGGAGTTTATAAAGTTTTCAATGGAAAAGATAACATAA GTAAAGTTGCCATAATCGACACATATAAAGGTAAAAGGAATCTGTCCTATTGGGAAAGTCACTGCGACATGATTAATGGTACAGATGCAG CCTCATTTCCACCTTTTGTTGAGAAAAGCCAGGTATTGCAGTTCTTTTCTTCTGATATTTGCAGGTCAATCTATGCTGTATTTGAATCCG ACGTTAATCTGAAAGGAATCCCTGTGTATAGATTTGTTCTTCCATCCAAGGCCTTTGCCTCTCCAGTTGAAAACCCAGACAACTATTGTT TCTGCACAGAAAAAATTATCTCAAAAAATTGTACATCATATGGTGTGCTAGACATCAGCAAATGCAAAGAAGGGAGACCTGTGTACATTT CACTTCCTCATTTTCTGTATGCAAGTCCTGATGTTTCAGAACCTATTGATGGATTAAACCCAAATGAAGAAGAACATAGGACATACTTGG ATATTGAACCTATAACTGGATTCACTTTACAATTTGCAAAACGGCTGCAGGTCAACCTATTGGTCAAGCCATCAGAAAAAATTCAAGTAT TAAAGAATCTGAAGAGGAACTATATTGTGCCTATTCTTTGGCTTAATGAGACTGGGACCATTGGTGATGAGAAGGCAAACATGTTCAGAA GTCAAGTAACTGGAAAAATAAACCTCCTTGGCCTGATAGAAATGATCTTACTCAGTGTTGGTGTGGTGATGTTTGTTGCTTTTATGATTT CATATTGTGCATGCAGATCGAAAACAATAAAATAAGTAAGTATGTACCAAAAAATATTGCTTCAATAATATTAGCTTATATATTACTTGT TTTCACTTTATCAAAGAGAAGTTACATATTAGGCCATATATATTTCTAGACATGTCTAGCCACTGATCATTTTTAAATATAGGTAAATAA ACCTATAAATATTATCACGCAGATCACTAAAGTATATCTTTAATTCTGGGAGAAATGAGATAAAAGATGTACTTGTGACCATTGTAACAA >80278_80278_1_SEMA3C-CD36_SEMA3C_chr7_80545995_ENST00000265361_CD36_chr7_80293722_ENST00000309881_length(amino acids)=271AA_BP=2 MMYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVY RFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTL QFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTI -------------------------------------------------------------- >80278_80278_2_SEMA3C-CD36_SEMA3C_chr7_80545995_ENST00000265361_CD36_chr7_80293722_ENST00000435819_length(transcript)=1737nt_BP=665nt GGACTGCGAAAGGAGCAGGGTTGCGGAGCTAGGGCTCCAGCCTGCGGCCGCGCATTCTTGCGTCTGGCCAGCCGCGAGCTCTAAGGGTCG GCCCCGCCCGGTCCGCCCCCGCGGCTCCCTGCCAGGCTCTCGCGGGCGCGCTCGGGGTGGGGCCTCGCGGCTGGCGGAGATGCGGCCGGG GCTGCGCGGTGGTGATGCGAGCCTGCAGGGCGGCGCGCCGGGGCAGCCGGAGCCGCGCGCCGCGGCGCTGTAATCGGACACCAAGAGCGC TCGCCCCCGGCCTCCGGCCACTTTCCATTCACTCCGAGGTGCTTGATTGAGCGACGCGGAGAAGAGCTCCGGGTGCCGCGGCACTGCAGC GCTGAGATTCCTTTACAAAGAAACTCAGAGGACCGGGAAGAAAGAATTTCACCTTTGCGACGTGCTAGAAAATAAGGTCGTCTGGGAAAA GGACTGGAGACACAAGCGCATCCAACCCCGGTAGCAAACTGATGACTTTTCCGTGCTGATTTCTTTCAACCTCGGTATTTTCCCTTGGAT ATTAACTTGCATATCTGAAGAAATGGCATTCCGGACAATTTGCGTGTTGGTTGGAGTATTTATTTGTTCTATCTGTGTGAAAGGATCTTC CCAGCCCCAAGCAAGAGTTTATTTAACATTTGATGTACAACAATACTGCAGATGGAGTTTATAAAGTTTTCAATGGAAAAGATAACATAA GTAAAGTTGCCATAATCGACACATATAAAGGTAAAAGGAATCTGTCCTATTGGGAAAGTCACTGCGACATGATTAATGGTACAGATGCAG CCTCATTTCCACCTTTTGTTGAGAAAAGCCAGGTATTGCAGTTCTTTTCTTCTGATATTTGCAGGTCAATCTATGCTGTATTTGAATCCG ACGTTAATCTGAAAGGAATCCCTGTGTATAGATTTGTTCTTCCATCCAAGGCCTTTGCCTCTCCAGTTGAAAACCCAGACAACTATTGTT TCTGCACAGAAAAAATTATCTCAAAAAATTGTACATCATATGGTGTGCTAGACATCAGCAAATGCAAAGAAGGGAGACCTGTGTACATTT CACTTCCTCATTTTCTGTATGCAAGTCCTGATGTTTCAGAACCTATTGATGGATTAAACCCAAATGAAGAAGAACATAGGACATACTTGG ATATTGAACCTATAACTGGATTCACTTTACAATTTGCAAAACGGCTGCAGGTCAACCTATTGGTCAAGCCATCAGAAAAAATTCAAGTAT TAAAGAATCTGAAGAGGAACTATATTGTGCCTATTCTTTGGCTTAATGAGACTGGGACCATTGGTGATGAGAAGGCAAACATGTTCAGAA GTCAAGTAACTGGAAAAATAAACCTCCTTGGCCTGATAGAAATGATCTTACTCAGTGTTGGTGTGGTGATGTTTGTTGCTTTTATGATTT CATATTGTGCATGCAGATCGAAAACAATAAAATAAGTAAGTATGTACCAAAAAATATTGCTTCAATAATATTAGCTTATATATTACTTGT TTTCACTTTATCAAAGAGAAGTTACATATTAGGCCATATATATTTCTAGACATGTCTAGCCACTGATCATTTTTAAATATAGGTAAATAA ACCTATAAATATTATCACGCAGATCACTAAAGTATATCTTTAATTCTGGGAGAAATGAGATAAAAGATGTACTTGTGACCATTGTAACAA >80278_80278_2_SEMA3C-CD36_SEMA3C_chr7_80545995_ENST00000265361_CD36_chr7_80293722_ENST00000435819_length(amino acids)=271AA_BP=2 MMYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVY RFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTL QFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTI -------------------------------------------------------------- >80278_80278_3_SEMA3C-CD36_SEMA3C_chr7_80545995_ENST00000265361_CD36_chr7_80293722_ENST00000534394_length(transcript)=1744nt_BP=665nt GGACTGCGAAAGGAGCAGGGTTGCGGAGCTAGGGCTCCAGCCTGCGGCCGCGCATTCTTGCGTCTGGCCAGCCGCGAGCTCTAAGGGTCG GCCCCGCCCGGTCCGCCCCCGCGGCTCCCTGCCAGGCTCTCGCGGGCGCGCTCGGGGTGGGGCCTCGCGGCTGGCGGAGATGCGGCCGGG GCTGCGCGGTGGTGATGCGAGCCTGCAGGGCGGCGCGCCGGGGCAGCCGGAGCCGCGCGCCGCGGCGCTGTAATCGGACACCAAGAGCGC TCGCCCCCGGCCTCCGGCCACTTTCCATTCACTCCGAGGTGCTTGATTGAGCGACGCGGAGAAGAGCTCCGGGTGCCGCGGCACTGCAGC GCTGAGATTCCTTTACAAAGAAACTCAGAGGACCGGGAAGAAAGAATTTCACCTTTGCGACGTGCTAGAAAATAAGGTCGTCTGGGAAAA GGACTGGAGACACAAGCGCATCCAACCCCGGTAGCAAACTGATGACTTTTCCGTGCTGATTTCTTTCAACCTCGGTATTTTCCCTTGGAT ATTAACTTGCATATCTGAAGAAATGGCATTCCGGACAATTTGCGTGTTGGTTGGAGTATTTATTTGTTCTATCTGTGTGAAAGGATCTTC CCAGCCCCAAGCAAGAGTTTATTTAACATTTGATGTACAACAATACTGCAGATGGAGTTTATAAAGTTTTCAATGGAAAAGATAACATAA GTAAAGTTGCCATAATCGACACATATAAAGGTAAAAGGAATCTGTCCTATTGGGAAAGTCACTGCGACATGATTAATGGTACAGATGCAG CCTCATTTCCACCTTTTGTTGAGAAAAGCCAGGTATTGCAGTTCTTTTCTTCTGATATTTGCAGGTCAATCTATGCTGTATTTGAATCCG ACGTTAATCTGAAAGGAATCCCTGTGTATAGATTTGTTCTTCCATCCAAGGCCTTTGCCTCTCCAGTTGAAAACCCAGACAACTATTGTT TCTGCACAGAAAAAATTATCTCAAAAAATTGTACATCATATGGTGTGCTAGACATCAGCAAATGCAAAGAAGGGAGACCTGTGTACATTT CACTTCCTCATTTTCTGTATGCAAGTCCTGATGTTTCAGAACCTATTGATGGATTAAACCCAAATGAAGAAGAACATAGGACATACTTGG ATATTGAACCTATAACTGGATTCACTTTACAATTTGCAAAACGGCTGCAGGTCAACCTATTGGTCAAGCCATCAGAAAAAATTCAAGTAT TAAAGAATCTGAAGAGGAACTATATTGTGCCTATTCTTTGGCTTAATGAGACTGGGACCATTGGTGATGAGAAGGCAAACATGTTCAGAA GTCAAGTAACTGGAAAAATAAACCTCCTTGGCCTGATAGAAATGATCTTACTCAGTGTTGGTGTGGTGATGTTTGTTGCTTTTATGATTT CATATTGTGCATGCAGATCGAAAACAATAAAATAAGTAAGTATGTACCAAAAAATATTGCTTCAATAATATTAGCTTATATATTACTTGT TTTCACTTTATCAAAGAGAAGTTACATATTAGGCCATATATATTTCTAGACATGTCTAGCCACTGATCATTTTTAAATATAGGTAAATAA ACCTATAAATATTATCACGCAGATCACTAAAGTATATCTTTAATTCTGGGAGAAATGAGATAAAAGATGTACTTGTGACCATTGTAACAA >80278_80278_3_SEMA3C-CD36_SEMA3C_chr7_80545995_ENST00000265361_CD36_chr7_80293722_ENST00000534394_length(amino acids)=271AA_BP=2 MMYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVY RFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTL QFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTI -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for SEMA3C-CD36 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000309881 | 5 | 14 | 460_472 | 203.0 | 473.0 | PTK2%2C PXN and LYN | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000394788 | 5 | 14 | 460_472 | 203.0 | 473.0 | PTK2%2C PXN and LYN | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000432207 | 4 | 13 | 460_472 | 203.0 | 473.0 | PTK2%2C PXN and LYN | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000435819 | 8 | 17 | 460_472 | 203.0 | 473.0 | PTK2%2C PXN and LYN | |
Tgene | CD36 | chr7:80545995 | chr7:80293722 | ENST00000447544 | 5 | 15 | 460_472 | 203.0 | 657.6666666666666 | PTK2%2C PXN and LYN |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for SEMA3C-CD36 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for SEMA3C-CD36 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |