|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:ATRX-MAGT1 (FusionGDB2 ID:8356) |
Fusion Gene Summary for ATRX-MAGT1 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: ATRX-MAGT1 | Fusion gene ID: 8356 | Hgene | Tgene | Gene symbol | ATRX | MAGT1 | Gene ID | 546 | 84061 |
| Gene name | ATRX chromatin remodeler | magnesium transporter 1 | |
| Synonyms | JMS|MRX52|RAD54|RAD54L|XH2|XNP|ZNF-HX | CDG1CC|IAP|MRX95|OST3B|PRO0756|SLC58A1|XMEN|bA217H1.1 | |
| Cytomap | Xq21.1 | Xq21.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | transcriptional regulator ATRXATP-dependent helicase ATRXX-linked helicase IIX-linked nuclear proteinalpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) | magnesium transporter protein 1dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1implantation-associated proteinoligosaccharyl transferase subunit MAGT1oligosaccharyltransferase 3 homolog B | |
| Modification date | 20200313 | 20200327 | |
| UniProtAcc | P46100 | Q9H0U3 | |
| Ensembl transtripts involved in fusion gene | ENST00000373341, ENST00000373344, ENST00000395603, ENST00000480283, | ENST00000373336, ENST00000358075, | |
| Fusion gene scores | * DoF score | 17 X 13 X 9=1989 | 7 X 7 X 4=196 |
| # samples | 23 | 8 | |
| ** MAII score | log2(23/1989*10)=-3.11233750988937 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(8/196*10)=-1.29278174922785 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: ATRX [Title/Abstract] AND MAGT1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | ATRX(76972608)-MAGT1(77112994), # samples:1 ATRX(76733729)-MAGT1(77116313), # samples:1 MAGT1(77150806)-ATRX(76972720), # samples:1 MAGT1(77096743)-ATRX(76876000), # samples:1 MAGT1(77150806)-ATRX(76872198), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | ATRX-MAGT1 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. ATRX-MAGT1 seems lost the major protein functional domain in Hgene partner, which is a epigenetic factor due to the frame-shifted ORF. ATRX-MAGT1 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. MAGT1-ATRX seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. MAGT1-ATRX seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. MAGT1-ATRX seems lost the major protein functional domain in Tgene partner, which is a epigenetic factor due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | ATRX | GO:0006334 | nucleosome assembly | 20651253 |
| Hgene | ATRX | GO:0006338 | chromatin remodeling | 20651253 |
| Fusion gene breakpoints across ATRX (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across MAGT1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | SKCM | TCGA-ER-A3ES-06A | ATRX | chrX | 76972608 | - | MAGT1 | chrX | 77112994 | - |
| ChiTaRS5.0 | N/A | BF337151 | ATRX | chrX | 76733729 | - | MAGT1 | chrX | 77116313 | - |
Top |
Fusion Gene ORF analysis for ATRX-MAGT1 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| 5CDS-intron | ENST00000373341 | ENST00000373336 | ATRX | chrX | 76972608 | - | MAGT1 | chrX | 77112994 | - |
| 5CDS-intron | ENST00000373344 | ENST00000373336 | ATRX | chrX | 76972608 | - | MAGT1 | chrX | 77112994 | - |
| 5CDS-intron | ENST00000395603 | ENST00000373336 | ATRX | chrX | 76972608 | - | MAGT1 | chrX | 77112994 | - |
| 5UTR-3CDS | ENST00000480283 | ENST00000358075 | ATRX | chrX | 76972608 | - | MAGT1 | chrX | 77112994 | - |
| 5UTR-intron | ENST00000480283 | ENST00000373336 | ATRX | chrX | 76972608 | - | MAGT1 | chrX | 77112994 | - |
| Frame-shift | ENST00000373344 | ENST00000358075 | ATRX | chrX | 76972608 | - | MAGT1 | chrX | 77112994 | - |
| Frame-shift | ENST00000395603 | ENST00000358075 | ATRX | chrX | 76972608 | - | MAGT1 | chrX | 77112994 | - |
| In-frame | ENST00000373341 | ENST00000358075 | ATRX | chrX | 76972608 | - | MAGT1 | chrX | 77112994 | - |
| intron-intron | ENST00000373341 | ENST00000358075 | ATRX | chrX | 76733729 | - | MAGT1 | chrX | 77116313 | - |
| intron-intron | ENST00000373341 | ENST00000373336 | ATRX | chrX | 76733729 | - | MAGT1 | chrX | 77116313 | - |
| intron-intron | ENST00000373344 | ENST00000358075 | ATRX | chrX | 76733729 | - | MAGT1 | chrX | 77116313 | - |
| intron-intron | ENST00000373344 | ENST00000373336 | ATRX | chrX | 76733729 | - | MAGT1 | chrX | 77116313 | - |
| intron-intron | ENST00000395603 | ENST00000358075 | ATRX | chrX | 76733729 | - | MAGT1 | chrX | 77116313 | - |
| intron-intron | ENST00000395603 | ENST00000373336 | ATRX | chrX | 76733729 | - | MAGT1 | chrX | 77116313 | - |
| intron-intron | ENST00000480283 | ENST00000358075 | ATRX | chrX | 76733729 | - | MAGT1 | chrX | 77116313 | - |
| intron-intron | ENST00000480283 | ENST00000373336 | ATRX | chrX | 76733729 | - | MAGT1 | chrX | 77116313 | - |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000373341 | ATRX | chrX | 76972608 | - | ENST00000358075 | MAGT1 | chrX | 77112994 | - | 3587 | 113 | 119 | 730 | 203 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000373341 | ENST00000358075 | ATRX | chrX | 76972608 | - | MAGT1 | chrX | 77112994 | - | 0.004765773 | 0.9952342 |
Top |
Fusion Genomic Features for ATRX-MAGT1 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for ATRX-MAGT1 |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chrX:76972608/chrX:77112994) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| ATRX | MAGT1 |
| FUNCTION: Involved in transcriptional regulation and chromatin remodeling. Facilitates DNA replication in multiple cellular environments and is required for efficient replication of a subset of genomic loci. Binds to DNA tandem repeat sequences in both telomeres and euchromatin and in vitro binds DNA quadruplex structures. May help stabilizing G-rich regions into regular chromatin structures by remodeling G4 DNA and incorporating H3.3-containing nucleosomes. Catalytic component of the chromatin remodeling complex ATRX:DAXX which has ATP-dependent DNA translocase activity and catalyzes the replication-independent deposition of histone H3.3 in pericentric DNA repeats outside S-phase and telomeres, and the in vitro remodeling of H3.3-containing nucleosomes. Its heterochromatin targeting is proposed to involve a combinatorial readout of histone H3 modifications (specifically methylation states of H3K9 and H3K4) and association with CBX5. Involved in maintaining telomere structural integrity in embryonic stem cells which probably implies recruitment of CBX5 to telomeres. Reports on the involvement in transcriptional regulation of telomeric repeat-containing RNA (TERRA) are conflicting; according to a report, it is not sufficient to decrease chromatin condensation at telomeres nor to increase expression of telomeric RNA in fibroblasts (PubMed:24500201). May be involved in telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines. Acts as negative regulator of chromatin incorporation of transcriptionally repressive histone MACROH2A1, particularily at telomeres and the alpha-globin cluster in erythroleukemic cells. Participates in the allele-specific gene expression at the imprinted IGF2/H19 gene locus. On the maternal allele, required for the chromatin occupancy of SMC1 and CTCTF within the H19 imprinting control region (ICR) and involved in esatblishment of histone tails modifications in the ICR. May be involved in brain development and facial morphogenesis. Binds to zinc-finger coding genes with atypical chromatin signatures and regulates its H3K9me3 levels. Forms a complex with ZNF274, TRIM28 and SETDB1 to facilitate the deposition and maintenance of H3K9me3 at the 3' exons of zinc-finger genes (PubMed:27029610). {ECO:0000269|PubMed:12953102, ECO:0000269|PubMed:14990586, ECO:0000269|PubMed:20504901, ECO:0000269|PubMed:20651253, ECO:0000269|PubMed:21029860, ECO:0000269|PubMed:22391447, ECO:0000269|PubMed:22829774, ECO:0000269|PubMed:24500201, ECO:0000269|PubMed:27029610}. | FUNCTION: Acts as accessory component of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Involved in N-glycosylation of STT3B-dependent substrates. Specifically required for the glycosylation of a subset of acceptor sites that are near cysteine residues; in this function seems to act redundantly with TUSC3. In its oxidized form proposed to form transient mixed disulfides with a glycoprotein substrate to facilitate access of STT3B to the unmodified acceptor site. Has also oxidoreductase-independent functions in the STT3B-containing OST complex possibly involving substrate recognition. {ECO:0000269|PubMed:25135935, ECO:0000269|PubMed:26864433, ECO:0000269|PubMed:31036665, ECO:0000305}.; FUNCTION: May be involved in Mg(2+) transport in epithelial cells. {ECO:0000305|PubMed:15804357, ECO:0000305|PubMed:19717468}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | MAGT1 | chrX:76972608 | chrX:77112994 | ENST00000358075 | 2 | 10 | 206_209 | 162 | 368.0 | Topological domain | Cytoplasmic | |
| Tgene | MAGT1 | chrX:76972608 | chrX:77112994 | ENST00000358075 | 2 | 10 | 231_270 | 162 | 368.0 | Topological domain | Extracellular | |
| Tgene | MAGT1 | chrX:76972608 | chrX:77112994 | ENST00000358075 | 2 | 10 | 292_300 | 162 | 368.0 | Topological domain | Cytoplasmic | |
| Tgene | MAGT1 | chrX:76972608 | chrX:77112994 | ENST00000358075 | 2 | 10 | 322_335 | 162 | 368.0 | Topological domain | Extracellular | |
| Tgene | MAGT1 | chrX:76972608 | chrX:77112994 | ENST00000358075 | 2 | 10 | 185_205 | 162 | 368.0 | Transmembrane | Helical | |
| Tgene | MAGT1 | chrX:76972608 | chrX:77112994 | ENST00000358075 | 2 | 10 | 210_230 | 162 | 368.0 | Transmembrane | Helical | |
| Tgene | MAGT1 | chrX:76972608 | chrX:77112994 | ENST00000358075 | 2 | 10 | 271_291 | 162 | 368.0 | Transmembrane | Helical | |
| Tgene | MAGT1 | chrX:76972608 | chrX:77112994 | ENST00000358075 | 2 | 10 | 301_321 | 162 | 368.0 | Transmembrane | Helical |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 1151_1156 | 44 | 2493.0 | Compositional bias | Note=Poly-Ser |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 1166_1169 | 44 | 2493.0 | Compositional bias | Note=Poly-Lys |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 1202_1206 | 44 | 2493.0 | Compositional bias | Note=Poly-Ser |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 1259_1266 | 44 | 2493.0 | Compositional bias | Note=Poly-Asp |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 1443_1466 | 44 | 2493.0 | Compositional bias | Note=Poly-Glu |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 1499_1502 | 44 | 2493.0 | Compositional bias | Note=Poly-Glu |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 1929_1939 | 44 | 2493.0 | Compositional bias | Note=Poly-Lys |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 1941_1948 | 44 | 2493.0 | Compositional bias | Note=Poly-Ser |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 2222_2225 | 44 | 2493.0 | Compositional bias | Note=Poly-Lys |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 2262_2265 | 44 | 2493.0 | Compositional bias | Note=Poly-Glu |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 2420_2425 | 44 | 2493.0 | Compositional bias | Note=Poly-Gln |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 745_750 | 44 | 2493.0 | Compositional bias | Note=Poly-Ser |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 1151_1156 | 44 | 2455.0 | Compositional bias | Note=Poly-Ser |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 1166_1169 | 44 | 2455.0 | Compositional bias | Note=Poly-Lys |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 1202_1206 | 44 | 2455.0 | Compositional bias | Note=Poly-Ser |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 1259_1266 | 44 | 2455.0 | Compositional bias | Note=Poly-Asp |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 1443_1466 | 44 | 2455.0 | Compositional bias | Note=Poly-Glu |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 1499_1502 | 44 | 2455.0 | Compositional bias | Note=Poly-Glu |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 1929_1939 | 44 | 2455.0 | Compositional bias | Note=Poly-Lys |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 1941_1948 | 44 | 2455.0 | Compositional bias | Note=Poly-Ser |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 2222_2225 | 44 | 2455.0 | Compositional bias | Note=Poly-Lys |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 2262_2265 | 44 | 2455.0 | Compositional bias | Note=Poly-Glu |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 2420_2425 | 44 | 2455.0 | Compositional bias | Note=Poly-Gln |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 745_750 | 44 | 2455.0 | Compositional bias | Note=Poly-Ser |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 1581_1768 | 44 | 2493.0 | Domain | Helicase ATP-binding |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 159_296 | 44 | 2493.0 | Domain | ADD |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 2025_2205 | 44 | 2493.0 | Domain | Helicase C-terminal |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 1581_1768 | 44 | 2455.0 | Domain | Helicase ATP-binding |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 159_296 | 44 | 2455.0 | Domain | ADD |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 2025_2205 | 44 | 2455.0 | Domain | Helicase C-terminal |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 1719_1722 | 44 | 2493.0 | Motif | Note=DEGH box |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 581_594 | 44 | 2493.0 | Motif | Note=PxVxL motif |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 1719_1722 | 44 | 2455.0 | Motif | Note=DEGH box |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 581_594 | 44 | 2455.0 | Motif | Note=PxVxL motif |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 1594_1601 | 44 | 2493.0 | Nucleotide binding | ATP |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 1594_1601 | 44 | 2455.0 | Nucleotide binding | ATP |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 170_206 | 44 | 2493.0 | Zinc finger | GATA-type%3B atypical |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 217_272 | 44 | 2493.0 | Zinc finger | PHD-type%3B atypical |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 170_206 | 44 | 2455.0 | Zinc finger | GATA-type%3B atypical |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 217_272 | 44 | 2455.0 | Zinc finger | PHD-type%3B atypical |
| Tgene | MAGT1 | chrX:76972608 | chrX:77112994 | ENST00000358075 | 2 | 10 | 47_175 | 162 | 368.0 | Domain | Note=Thioredoxin | |
| Tgene | MAGT1 | chrX:76972608 | chrX:77112994 | ENST00000358075 | 2 | 10 | 30_184 | 162 | 368.0 | Topological domain | Extracellular |
Top |
Fusion Gene Sequence for ATRX-MAGT1 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >8356_8356_1_ATRX-MAGT1_ATRX_chrX_76972608_ENST00000373341_MAGT1_chrX_77112994_ENST00000358075_length(transcript)=3587nt_BP=113nt TGAAAGCAAGTTGAATACATTGGTGCAGAAGCTTCATGACTTCCTTGCACACTCATCAGAAGAATCTGAAGAAACAAGTTCTCCTCCACG ACTTGCAATGAATCAAAACACAGCTAAACATGAATTCAGCTCCAACTTTCATCAACTTTCCTGCAAAAGGGAAACCCAAACGGGGTGATA CATATGAGTTACAGGTGCGGGGTTTTTCAGCTGAGCAGATTGCCCGGTGGATCGCCGACAGAACTGATGTCAATATTAGAGTGATTAGAC CCCCAAATTATGCTGGTCCCCTTATGTTGGGATTGCTTTTGGCTGTTATTGGTGGACTTGTGTATCTTCGAAGAAGTAATATGGAATTTC TCTTTAATAAAACTGGATGGGCTTTTGCAGCTTTGTGTTTTGTGCTTGCTATGACATCTGGTCAAATGTGGAACCATATAAGAGGACCAC CATATGCCCATAAGAATCCCCACACGGGACATGTGAATTATATCCATGGAAGCAGTCAAGCCCAGTTTGTAGCTGAAACACACATTGTTC TTCTGTTTAATGGTGGAGTTACCTTAGGAATGGTGCTTTTATGTGAAGCTGCTACCTCTGACATGGATATTGGAAAGCGAAAGATAATGT GTGTGGCTGGTATTGGACTTGTTGTATTATTCTTCAGTTGGATGCTCTCTATTTTTAGATCTAAATATCATGGCTACCCATACAGCTTTC TGATGAGTTAAAAAGGTCCCAGAGATATATAGACACTGGAGTACTGGAAATTGAAAAACGAAAATCGTGTGTGTTTGAAAAGAAGAATGC AACTTGTATATTTTGTATTACCTCTTTTTTTCAAGTGATTTAAATAGTTAATCATTTAACCAAAGAAGATGTGTAGTGCCTTAACAAGCA ATCCTCTGTCAAAATCTGAGGTATTTGAAAATAATTATCCTCTTAACCTTCTCTTCCCAGTGAACTTTATGGAACATTTAATTTAGTACA ATTAAGTATATTATAAAAATTGTAAAACTACTACTTTGTTTTAGTTAGAACAAAGCTCAAAACTACTTTAGTTAACTTGGTCATCTGATT TTATATTGCCTTATCCAAAGATGGGGAAAGTAAGTCCTGACCAGGTGTTCCCACATATGCCTGTTACAGATAACTACATTAGGAATTCAT TCTTAGCTTCTTCATCTTTGTGTGGATGTGTATACTTTACGCATCTTTCCTTTTGAGTAGAGAAATTATGTGTGTCATGTGGTCTTCTGA AAATGGAACACCATTCTTCAGAGCACACGTCTAGCCCTCAGCAAGACAGTTGTTTCTCCTCCTCCTTGCATATTTCCTACTGAAATACAG TGCTGTCTATGATTGTTTTTGTTTTGTTGTTTTTTTGAGACGGTCTCGCTGTGTCACACAGGCTGGAGTGCAGTGGCGTGAGCTCGGCTG ACTGCAAACTCTGCCTCCCAGGTTTAAGCGATTCTCCTGTCACAGCTTCCCAAGTAGCTGGGATTTACAGGTGTGCACCGCCATGCCAGG CTAATTTTTGTGTTTTTAGTAGAGACAGGGTTTCGCCAAGTTGTCCAGGCTGGTCTTGAACTCCTGGGCTCAAGTGATCCGCCCGCCTCA GTCTCCCAAAGTGCGAGGATGACATGTGTGAGCTACCACACCAGCAATGTCTATGCTTCTCGATAGCTGTGAACATGAAAAGACATCTAT TGGGAGTCCGAGGCAGGTGGATTGCTTGAGGCCAGGAGTTAGAGACCAGCCTGGCCAACAAGGCAAAACCCCGTCTCTACTAAAAATATG AAAATTAGCTGGGCTTGGTGGCTCATGCCTATAATCCTAGCTACTTGGGAGGCTGAGGCACGAGACTTGCTTAATACCTGGGAGGCGGAG ATTGCAGTGAGCCGAGATCACGCTACTGCGCTCCAGCCTGAGTGATAGAGTGAGACTCTGTCTCAAAAAAAAGTATCTCTAAATACAGGA TTATAATTTCTGCTTGAGTATGGTGTTAACTACCTTGTATTTAGAAAGATTTCAGATTCATTCCATCTCCTTAGTTTTCTTTTAAGGTGA CCCATCTGTGATAAAAATATAGCTTAGTGCTAAAATCAGTGTAACTTATACATGGCCTAAAATGTTTCTACAAATTAGAGTTTGTCACTT ATTCCATTTGTACCTAAGAGAAAAATAGGCTCAGTTAGAAAAGGACTCCCTGGCCAGGCGCAGTGACTTACGCCTGTAATCTCAGCACTT TGGGAGGCCAAGGCAGGCAGATCACGAGGTCAGGAGTTCGAGACCATCCTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAATATAAA AATTAGCTGGGTGTGGTGGCAGGAGCCTGTAATCCCAGCTACACAGGAGGCTGAGGCACGAGAATCACTTGAACTCAGGAGATGGAGGTT TCAGTGAGCCAAGATCACACCACTGCACTCCAGCCTGGCAACAGAGCGAGACTCCATCTCAAAAAAAAAAAAAAAAGTAAGAAAGAAAAG GACTCCCTTAGAATGGGAAAGAAAAATCATAAAATATTGAGCTGATGCCTGTATATAGAAATTAAGCGTTTCTCGAAAGCTGTTCTATGT TTTGCTGTTATTTTAGTCTTTATTCTCTTCCTTTAGGTGGAGAAACAAAGTACCAATTTGAAGGGATTTTTTTTATTTTGTCTTTTGGTT TCTGTCAGTAGAAATAACCATATGTGCTAACCAAATTTCTGTGAAGAATGTTTTCATGGTTATCATTATATCTAACTATAACCTCCCCCA TAGTTATGAAGAGTAACCTGAAATGCCACTATTGTGGAAATAGGATAATTGTAATTGTGAAAAAATAATTTTAAGGAAATCTTACAAGTA TTACATTAAAAAGATACTATGACTGCCACCTGCCATTTACCTTCTAATAACCCTGCCATGTGGTTTGCAGAAAGAGATGGATATAGTAGC CTCAGAAGAAATATTTTATGTGGGTTTTTTGTTTTTCGTTACTAGATTTCATGGATGAGGGGATATGGTTGACCTTTTACTTTTTAATGG AGCAGCCAGTTTTTGTTAATTACTCACTTGTAAATTGTGAGATTCTGAATTCCTTACCTGCTATTCTTGTACTTGTCTCAGGCCAAATCT ATGCTGTGGTTCTTATGAGACTTGTATGAAGATGCCCTGATTTGTACAGATTGACCACGGGAATACTACTGCCATGTAATCTGTATAGTT CCAGATAATTTGTCATGAACATTGACAGAATGACAATTTTTTGTATTTGCTTTTTCTCCCTTTAAGAGCACATTCTTCTGTAAGGAGAAA GGCAGCATTCTGGCTAAAATGTGTAGAAGGTAATTTACTACACTTATAAAATAGTGTGACTTTTGTGAAAATTTTGAATTAGCTTTCATA TGAAGTGCCTTAAGTAGACTCTTCATTTACTTTTCTGGTAATGGTTTAAATATCATTTGTTATGCATTTTTAAGATACAGTTCAGAATGA >8356_8356_1_ATRX-MAGT1_ATRX_chrX_76972608_ENST00000373341_MAGT1_chrX_77112994_ENST00000358075_length(amino acids)=203AA_BP=0 MNSAPTFINFPAKGKPKRGDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFA ALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVL -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ATRX-MAGT1 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 1189_1326 | 44.333333333333336 | 2493.0 | DAXX |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 1189_1326 | 44.333333333333336 | 2455.0 | DAXX |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000373344 | - | 2 | 35 | 2010_2280 | 44.333333333333336 | 2493.0 | MECP2 |
| Hgene | ATRX | chrX:76972608 | chrX:77112994 | ENST00000395603 | - | 2 | 34 | 2010_2280 | 44.333333333333336 | 2455.0 | MECP2 |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ATRX-MAGT1 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for ATRX-MAGT1 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies