|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:BAZ1A-NKX2-1 (FusionGDB2 ID:9015) |
Fusion Gene Summary for BAZ1A-NKX2-1 |
Fusion gene summary |
Fusion gene information | Fusion gene name: BAZ1A-NKX2-1 | Fusion gene ID: 9015 | Hgene | Tgene | Gene symbol | BAZ1A | NKX2-1 | Gene ID | 11177 | 7080 |
Gene name | bromodomain adjacent to zinc finger domain 1A | NK2 homeobox 1 | |
Synonyms | ACF1|WALp1|WCRF180|hACF1 | BCH|BHC|NK-2|NKX2.1|NKX2A|NMTC1|T/EBP|TEBP|TITF1|TTF-1|TTF1 | |
Cytomap | 14q13.1-q13.2 | 14q13.3 | |
Type of gene | protein-coding | protein-coding | |
Description | bromodomain adjacent to zinc finger domain protein 1AATP-dependent chromatin remodeling proteinATP-utilizing chromatin assembly and remodeling factor 1CHRAC subunit ACF1hWALp1williams syndrome transcription factor-related chromatin-remodeling factor | homeobox protein Nkx-2.1NK-2 homolog Ahomeobox protein NK-2 homolog Athyroid nuclear factor 1thyroid transcription factor 1thyroid-specific enhancer-binding protein | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q9NRL2 | P43699 | |
Ensembl transtripts involved in fusion gene | ENST00000358716, ENST00000360310, ENST00000382422, ENST00000553853, | ENST00000498187, ENST00000518149, ENST00000522719, ENST00000354822, | |
Fusion gene scores | * DoF score | 12 X 9 X 5=540 | 1 X 1 X 1=1 |
# samples | 12 | 1 | |
** MAII score | log2(12/540*10)=-2.16992500144231 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(1/1*10)=3.32192809488736 | |
Context | PubMed: BAZ1A [Title/Abstract] AND NKX2-1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | BAZ1A(35331250)-NKX2-1(36988575), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | BAZ1A-NKX2-1 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. BAZ1A-NKX2-1 seems lost the major protein functional domain in Hgene partner, which is a epigenetic factor due to the frame-shifted ORF. BAZ1A-NKX2-1 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. BAZ1A-NKX2-1 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. BAZ1A-NKX2-1 seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. BAZ1A-NKX2-1 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. BAZ1A-NKX2-1 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. BAZ1A-NKX2-1 seems lost the major protein functional domain in Tgene partner, which is a transcription factor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | BAZ1A | GO:0006261 | DNA-dependent DNA replication | 12434153 |
Tgene | NKX2-1 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 23143308 |
Tgene | NKX2-1 | GO:0010628 | positive regulation of gene expression | 16960125 |
Tgene | NKX2-1 | GO:0010719 | negative regulation of epithelial to mesenchymal transition | 19293183 |
Tgene | NKX2-1 | GO:0030336 | negative regulation of cell migration | 19293183 |
Tgene | NKX2-1 | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway | 19293183 |
Tgene | NKX2-1 | GO:0045893 | positive regulation of transcription, DNA-templated | 14960358 |
Tgene | NKX2-1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 7559607|7713914|16960125 |
Fusion gene breakpoints across BAZ1A (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across NKX2-1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LUAD | TCGA-L9-A444-01A | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
Top |
Fusion Gene ORF analysis for BAZ1A-NKX2-1 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-5UTR | ENST00000358716 | ENST00000498187 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
5CDS-5UTR | ENST00000358716 | ENST00000518149 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
5CDS-5UTR | ENST00000358716 | ENST00000522719 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
5CDS-5UTR | ENST00000360310 | ENST00000498187 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
5CDS-5UTR | ENST00000360310 | ENST00000518149 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
5CDS-5UTR | ENST00000360310 | ENST00000522719 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
5CDS-5UTR | ENST00000382422 | ENST00000498187 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
5CDS-5UTR | ENST00000382422 | ENST00000518149 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
5CDS-5UTR | ENST00000382422 | ENST00000522719 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
5UTR-3CDS | ENST00000553853 | ENST00000354822 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
5UTR-5UTR | ENST00000553853 | ENST00000498187 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
5UTR-5UTR | ENST00000553853 | ENST00000518149 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
5UTR-5UTR | ENST00000553853 | ENST00000522719 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
Frame-shift | ENST00000358716 | ENST00000354822 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
Frame-shift | ENST00000360310 | ENST00000354822 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
In-frame | ENST00000382422 | ENST00000354822 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000382422 | BAZ1A | chr14 | 35331250 | - | ENST00000354822 | NKX2-1 | chr14 | 36988575 | - | 2730 | 720 | 28 | 1848 | 606 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000382422 | ENST00000354822 | BAZ1A | chr14 | 35331250 | - | NKX2-1 | chr14 | 36988575 | - | 0.01518999 | 0.98481005 |
Top |
Fusion Genomic Features for BAZ1A-NKX2-1 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for BAZ1A-NKX2-1 |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr14:35331250/chr14:36988575) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
BAZ1A | NKX2-1 |
FUNCTION: Component of the ACF complex, an ATP-dependent chromatin remodeling complex, that regulates spacing of nucleosomes using ATP to generate evenly spaced nucleosomes along the chromatin. The ATPase activity of the complex is regulated by the length of flanking DNA. Also involved in facilitating the DNA replication process. BAZ1A is the accessory, non-catalytic subunit of the complex which can enhance and direct the process provided by the ATPase subunit, SMARCA5, probably through targeting pericentromeric heterochromatin in late S phase. Moves end-positioned nucleosomes to a predominantly central position. May have a role in nuclear receptor-mediated transcription repression.; FUNCTION: Component of the histone-fold protein complex CHRAC complex which facilitates nucleosome sliding by the ACF complex and enhances ACF-mediated chromatin assembly. The C-terminal regions of both CHRAC1 and POLE1 are required for these functions. | FUNCTION: Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis. Forms a regulatory loop with GRHL2 that coordinates lung epithelial cell morphogenesis and differentiation. Activates the transcription of GNRHR and plays a role in enhancing the circadian oscillation of its gene expression. Represses the transcription of the circadian transcriptional repressor NR1D1 (By similarity). {ECO:0000250|UniProtKB:P23441, ECO:0000250|UniProtKB:P50220}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000358716 | - | 3 | 26 | 22_128 | 130 | 1525.0 | Domain | WAC |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000360310 | - | 3 | 27 | 22_128 | 130 | 1557.0 | Domain | WAC |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000382422 | - | 2 | 26 | 22_128 | 130 | 1557.0 | Domain | WAC |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000358716 | - | 3 | 26 | 1_128 | 130 | 1525.0 | Region | Note=Required for association with the CHRAC1/POLE3 complex |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000360310 | - | 3 | 27 | 1_128 | 130 | 1557.0 | Region | Note=Required for association with the CHRAC1/POLE3 complex |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000382422 | - | 2 | 26 | 1_128 | 130 | 1557.0 | Region | Note=Required for association with the CHRAC1/POLE3 complex |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000354822 | 0 | 3 | 234_243 | 25 | 402.0 | Compositional bias | Note=Poly-Gly | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000354822 | 0 | 3 | 246_253 | 25 | 402.0 | Compositional bias | Note=Poly-Gln | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000354822 | 0 | 3 | 294_303 | 25 | 402.0 | Compositional bias | Note=Poly-Ala | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000498187 | 0 | 2 | 234_243 | 0 | 372.0 | Compositional bias | Note=Poly-Gly | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000498187 | 0 | 2 | 246_253 | 0 | 372.0 | Compositional bias | Note=Poly-Gln | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000498187 | 0 | 2 | 294_303 | 0 | 372.0 | Compositional bias | Note=Poly-Ala | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000518149 | 0 | 3 | 234_243 | 0 | 372.0 | Compositional bias | Note=Poly-Gly | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000518149 | 0 | 3 | 246_253 | 0 | 372.0 | Compositional bias | Note=Poly-Gln | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000518149 | 0 | 3 | 294_303 | 0 | 372.0 | Compositional bias | Note=Poly-Ala | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000522719 | 1 | 4 | 234_243 | 0 | 372.0 | Compositional bias | Note=Poly-Gly | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000522719 | 1 | 4 | 246_253 | 0 | 372.0 | Compositional bias | Note=Poly-Gln | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000522719 | 1 | 4 | 294_303 | 0 | 372.0 | Compositional bias | Note=Poly-Ala | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000354822 | 0 | 3 | 161_220 | 25 | 402.0 | DNA binding | Homeobox | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000498187 | 0 | 2 | 161_220 | 0 | 372.0 | DNA binding | Homeobox | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000518149 | 0 | 3 | 161_220 | 0 | 372.0 | DNA binding | Homeobox | |
Tgene | NKX2-1 | chr14:35331250 | chr14:36988575 | ENST00000522719 | 1 | 4 | 161_220 | 0 | 372.0 | DNA binding | Homeobox |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000358716 | - | 3 | 26 | 306_397 | 130 | 1525.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000358716 | - | 3 | 26 | 634_709 | 130 | 1525.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000360310 | - | 3 | 27 | 306_397 | 130 | 1557.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000360310 | - | 3 | 27 | 634_709 | 130 | 1557.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000382422 | - | 2 | 26 | 306_397 | 130 | 1557.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000382422 | - | 2 | 26 | 634_709 | 130 | 1557.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000358716 | - | 3 | 26 | 1239_1257 | 130 | 1525.0 | Compositional bias | Note=Glu-rich |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000358716 | - | 3 | 26 | 487_491 | 130 | 1525.0 | Compositional bias | Note=Poly-Glu |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000360310 | - | 3 | 27 | 1239_1257 | 130 | 1557.0 | Compositional bias | Note=Glu-rich |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000360310 | - | 3 | 27 | 487_491 | 130 | 1557.0 | Compositional bias | Note=Poly-Glu |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000382422 | - | 2 | 26 | 1239_1257 | 130 | 1557.0 | Compositional bias | Note=Glu-rich |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000382422 | - | 2 | 26 | 487_491 | 130 | 1557.0 | Compositional bias | Note=Poly-Glu |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000358716 | - | 3 | 26 | 1446_1516 | 130 | 1525.0 | Domain | Bromo |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000358716 | - | 3 | 26 | 422_487 | 130 | 1525.0 | Domain | DDT |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000360310 | - | 3 | 27 | 1446_1516 | 130 | 1557.0 | Domain | Bromo |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000360310 | - | 3 | 27 | 422_487 | 130 | 1557.0 | Domain | DDT |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000382422 | - | 2 | 26 | 1446_1516 | 130 | 1557.0 | Domain | Bromo |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000382422 | - | 2 | 26 | 422_487 | 130 | 1557.0 | Domain | DDT |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000358716 | - | 3 | 26 | 1148_1198 | 130 | 1525.0 | Zinc finger | PHD-type |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000360310 | - | 3 | 27 | 1148_1198 | 130 | 1557.0 | Zinc finger | PHD-type |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000382422 | - | 2 | 26 | 1148_1198 | 130 | 1557.0 | Zinc finger | PHD-type |
Top |
Fusion Gene Sequence for BAZ1A-NKX2-1 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>9015_9015_1_BAZ1A-NKX2-1_BAZ1A_chr14_35331250_ENST00000382422_NKX2-1_chr14_36988575_ENST00000354822_length(transcript)=2730nt_BP=720nt CCCGCACTGCCCCCCGCGGCGGGGCGTCCTGCCCCATTGTGAGGCGGCGGCAGGACGAGAGGAGGTAGGGCGCGCTCGGGGGGCAGGGGC GGCGGCGGCTCCGCTCGCTCGACACCCGGGCAGCGGCAGGAACGAACTCGGCTCCGGTAGCGGCCGCGGCGCGTCAGTCACACAAAAGGC AGCCGAGCTTCTCCCAGCGCGCGGACCGGCCCACGCTGCCGCCGAGGGCTCCCCACCTTACCGGCTTTCCTTTCCCTCCAATTTTGATAG GGAAGCGGGGCCGGCGCGGGCGGCCGAGGGTCCAGGCGAGCCCGCGGGCGGACGGGAGATGCCGCTGCTACACCGAAAGCCGTTTGTGAG ACAGAAGCCGCCCGCGGACCTGCGGCCCGACGAGGAAGTTTTCTACTGTAAAGTCACCAACGAGATCTTCCGCCACTACGATGACTTTTT TGAACGAACCATTCTGTGCAACAGCCTTGTGTGGAGTTGTGCTGTGACGGGTAGACCTGGACTGACGTATCAGGAAGCACTTGAGTCAGA AAAAAAAGCAAGACAGAATCTTCAGAGTTTTCCAGAACCACTAATTATTCCAGTTTTATACTTGACCAGCCTTACCCATCGTTCGCGCTT ACATGAAATTTGTGATGATATCTTTGCATATGTCAAGGATCGATATTTTGTCGAAGAAACTGTGGAAGTCATTAGGAACAATGGTGCAAG CCGCCGCCGAATCATGTCGATGAGTCCAAAGCACACGACTCCGTTCTCAGTGTCTGACATCTTGAGTCCCCTGGAGGAAAGCTACAAGAA AGTGGGCATGGAGGGCGGCGGCCTCGGGGCTCCGCTGGCGGCGTACAGGCAGGGCCAGGCGGCACCGCCAACAGCGGCCATGCAGCAGCA CGCCGTGGGGCACCACGGCGCCGTCACCGCCGCCTACCACATGACGGCGGCGGGGGTGCCCCAGCTCTCGCACTCCGCCGTGGGGGGCTA CTGCAACGGCAACCTGGGCAACATGAGCGAGCTGCCGCCGTACCAGGACACCATGAGGAACAGCGCCTCTGGCCCCGGATGGTACGGCGC CAACCCAGACCCGCGCTTCCCCGCCATCTCCCGCTTCATGGGCCCGGCGAGCGGCATGAACATGAGCGGCATGGGCGGCCTGGGCTCGCT GGGGGACGTGAGCAAGAACATGGCCCCGCTGCCAAGCGCGCCGCGCAGGAAGCGCCGGGTGCTCTTCTCGCAGGCGCAGGTGTACGAGCT GGAGCGACGCTTCAAGCAACAGAAGTACCTGTCGGCGCCGGAGCGCGAGCACCTGGCCAGCATGATCCACCTGACGCCCACGCAGGTCAA GATCTGGTTCCAGAACCACCGCTACAAAATGAAGCGCCAGGCCAAGGACAAGGCGGCGCAGCAGCAACTGCAGCAGGACAGCGGCGGCGG CGGGGGCGGCGGGGGCACCGGGTGCCCGCAGCAGCAACAGGCTCAGCAGCAGTCGCCGCGACGCGTGGCGGTGCCGGTCCTGGTGAAAGA CGGCAAACCGTGCCAGGCGGGTGCCCCCGCGCCGGGCGCCGCCAGCCTACAAGGCCACGCGCAGCAGCAGGCGCAGCACCAGGCGCAGGC CGCGCAGGCGGCGGCAGCGGCCATCTCCGTGGGCAGCGGTGGCGCCGGCCTTGGCGCACACCCGGGCCACCAGCCAGGCAGCGCAGGCCA GTCTCCGGACCTGGCGCACCACGCCGCCAGCCCCGCGGCGCTGCAGGGCCAGGTATCCAGCCTGTCCCACCTGAACTCCTCGGGCTCGGA CTACGGCACCATGTCCTGCTCCACCTTGCTATACGGTCGGACCTGGTGAGAGGACGCCGGGCCGGCCCTAGCCCAGCGCTCTGCCTCACC GCTTCCCTCCTGCCCGCCACACAGACCACCATCCACCGCTGCTCCACGCGCTTCGACTTTTCTTAACAACCTGGCCGCGTTTAGACCAAG GAACAAAAAAACCACAAAGGCCAAACTGCTGGACGTCTTTCTTTTTTTCCCCCCCTAAAATTTGTGGGTTTTTTTTTTTAAAAAAAGAAA ATGAAAAACAACCAAGCGCATCCAATCTCAAGGAATCTTTAAGCAGAGAAGGGCATAAAACAGCTTTGGGGTGTCTTTTTTTGGTGATTC AAATGGGTTTTCCACGCTAGGGCGGGGCACAGATTGGAGAGGGCTCTGTGCTGACATGGCTCTGGACTCTAAAGACCAAACTTCACTCTG GGCACACTCTGCCAGCAAAGAGGACTCGCTTGTAAATACCAGGATTTTTTTTTTTTTTTGAAGGGAGGACGGGAGCTGGGGAGAGGAAAG AGTCTTCAACATAACCCACTTGTCACTGACACAAAGGAAGTGCCCCCTCCCCGGCACCCTCTGGCCGCCTAGGCTCAGCGGCGACCGCCC TCCGCGAAAATAGTTTGTTTAATGTGAACTTGTAGCTGTAAAACGCTGTCAAAAGTTGGACTAAATGCCTAGTTTTTAGTAATCTGTACA TTTTGTTGTAAAAAGAAAAACCACTCCCAGTCCCCAGCCCTTCACATTTTTTATGGGCATTGACAAATCTGTGTATATTATTTGGCAGTT TGGTATTTGCGGCGTCAGTCTTTTTCTGTTGTAACTTATGTAGATATTTGGCTTAAATATAGTTCCTAAGAAGCTTCTAATAAATTATAC >9015_9015_1_BAZ1A-NKX2-1_BAZ1A_chr14_35331250_ENST00000382422_NKX2-1_chr14_36988575_ENST00000354822_length(amino acids)=606AA_BP=230 MPHCEAAAGREEVGRARGAGAAAAPLARHPGSGRNELGSGSGRGASVTQKAAELLPARGPAHAAAEGSPPYRLSFPSNFDREAGPARAAE GPGEPAGGREMPLLHRKPFVRQKPPADLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRPGLTYQEALESEKKARQNLQS FPEPLIIPVLYLTSLTHRSRLHEICDDIFAYVKDRYFVEETVEVIRNNGASRRRIMSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLG APLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAI SRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYK MKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAIS -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for BAZ1A-NKX2-1 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000358716 | - | 3 | 26 | 667_933 | 130.66666666666666 | 1525.0 | SMARCA5 |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000360310 | - | 3 | 27 | 667_933 | 130.66666666666666 | 1557.0 | SMARCA5 |
Hgene | BAZ1A | chr14:35331250 | chr14:36988575 | ENST00000382422 | - | 2 | 26 | 667_933 | 130.66666666666666 | 1557.0 | SMARCA5 |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for BAZ1A-NKX2-1 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for BAZ1A-NKX2-1 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |