|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:TGDS-DAPK1 (FusionGDB2 ID:90422) |
Fusion Gene Summary for TGDS-DAPK1 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: TGDS-DAPK1 | Fusion gene ID: 90422 | Hgene | Tgene | Gene symbol | TGDS | DAPK1 | Gene ID | 23483 | 1612 |
| Gene name | TDP-glucose 4,6-dehydratase | death associated protein kinase 1 | |
| Synonyms | CATMANS|SDR2E1|TDPGD | DAPK|ROCO3 | |
| Cytomap | 13q32.1 | 9q21.33 | |
| Type of gene | protein-coding | protein-coding | |
| Description | dTDP-D-glucose 4,6-dehydratasegrowth-inhibiting protein 21short chain dehydrogenase/reductase family 2E, member 1 | death-associated protein kinase 1DAP kinase 1 | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | . | P53355 | |
| Ensembl transtripts involved in fusion gene | ENST00000261296, ENST00000498294, | ENST00000466188, ENST00000358077, ENST00000408954, ENST00000469640, ENST00000472284, ENST00000491893, | |
| Fusion gene scores | * DoF score | 1 X 1 X 1=1 | 9 X 8 X 6=432 |
| # samples | 1 | 9 | |
| ** MAII score | log2(1/1*10)=3.32192809488736 | log2(9/432*10)=-2.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: TGDS [Title/Abstract] AND DAPK1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | TGDS(95248305)-DAPK1(90321047), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | TGDS-DAPK1 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. TGDS-DAPK1 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. TGDS-DAPK1 seems lost the major protein functional domain in Tgene partner, which is a kinase due to the frame-shifted ORF. TGDS-DAPK1 seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | DAPK1 | GO:0006468 | protein phosphorylation | 10629061 |
| Tgene | DAPK1 | GO:0017148 | negative regulation of translation | 18995835 |
| Tgene | DAPK1 | GO:0035556 | intracellular signal transduction | 10629061 |
| Tgene | DAPK1 | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process | 16132846 |
| Tgene | DAPK1 | GO:0046777 | protein autophosphorylation | 10629061|12730201 |
| Tgene | DAPK1 | GO:0071346 | cellular response to interferon-gamma | 18995835 |
| Fusion gene breakpoints across TGDS (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across DAPK1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BRCA | TCGA-AO-A0J2-01A | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
Top |
Fusion Gene ORF analysis for TGDS-DAPK1 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| 5CDS-intron | ENST00000261296 | ENST00000466188 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
| Frame-shift | ENST00000261296 | ENST00000358077 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
| Frame-shift | ENST00000261296 | ENST00000408954 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
| In-frame | ENST00000261296 | ENST00000469640 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
| In-frame | ENST00000261296 | ENST00000472284 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
| In-frame | ENST00000261296 | ENST00000491893 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
| intron-3CDS | ENST00000498294 | ENST00000358077 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
| intron-3CDS | ENST00000498294 | ENST00000408954 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
| intron-3CDS | ENST00000498294 | ENST00000469640 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
| intron-3CDS | ENST00000498294 | ENST00000472284 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
| intron-3CDS | ENST00000498294 | ENST00000491893 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
| intron-intron | ENST00000498294 | ENST00000466188 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000261296 | TGDS | chr13 | 95248305 | - | ENST00000472284 | DAPK1 | chr9 | 90321047 | + | 2706 | 207 | 114 | 1439 | 441 |
| ENST00000261296 | TGDS | chr13 | 95248305 | - | ENST00000469640 | DAPK1 | chr9 | 90321047 | + | 2709 | 207 | 114 | 1439 | 441 |
| ENST00000261296 | TGDS | chr13 | 95248305 | - | ENST00000491893 | DAPK1 | chr9 | 90321047 | + | 1458 | 207 | 114 | 1439 | 441 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000261296 | ENST00000472284 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + | 0.00058704 | 0.999413 |
| ENST00000261296 | ENST00000469640 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + | 0.000589688 | 0.9994103 |
| ENST00000261296 | ENST00000491893 | TGDS | chr13 | 95248305 | - | DAPK1 | chr9 | 90321047 | + | 0.00768891 | 0.9923111 |
Top |
Fusion Genomic Features for TGDS-DAPK1 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| TGDS | chr13 | 95248304 | - | DAPK1 | chr9 | 90321046 | + | 2.32E-08 | 1 |
| TGDS | chr13 | 95248304 | - | DAPK1 | chr9 | 90321046 | + | 2.32E-08 | 1 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
 |
Top |
Fusion Protein Features for TGDS-DAPK1 |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr13:95248305/chr9:90321047) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| . | DAPK1 |
| FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. | FUNCTION: Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell deaths signal, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Phosphorylates PIN1 resulting in inhibition of its catalytic activity, nuclear localization, and cellular function. Phosphorylates TPM1, enhancing stress fiber formation in endothelial cells. Phosphorylates STX1A and significantly decreases its binding to STXBP1. Phosphorylates PRKD1 and regulates JNK signaling by binding and activating PRKD1 under oxidative stress. Phosphorylates BECN1, reducing its interaction with BCL2 and BCL2L1 and promoting the induction of autophagy. Phosphorylates TSC2, disrupting the TSC1-TSC2 complex and stimulating mTORC1 activity in a growth factor-dependent pathway. Phosphorylates RPS6, MYL9 and DAPK3. Acts as a signaling amplifier of NMDA receptors at extrasynaptic sites for mediating brain damage in stroke. Cerebral ischemia recruits DAPK1 into the NMDA receptor complex and it phosphorylates GRINB at Ser-1303 inducing injurious Ca(2+) influx through NMDA receptor channels, resulting in an irreversible neuronal death. Required together with DAPK3 for phosphorylation of RPL13A upon interferon-gamma activation which is causing RPL13A involvement in transcript-selective translation inhibition.; FUNCTION: Isoform 2 cannot induce apoptosis but can induce membrane blebbing. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 1312_1396 | 1020 | 1431.0 | Domain | Death | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 1312_1396 | 1020 | 1431.0 | Domain | Death | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 1312_1396 | 1020 | 1431.0 | Domain | Death | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 1162_1196 | 1020 | 1431.0 | Repeat | Note=ANK 10 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 1162_1196 | 1020 | 1431.0 | Repeat | Note=ANK 10 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 1162_1196 | 1020 | 1431.0 | Repeat | Note=ANK 10 |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 13_275 | 1020 | 1431.0 | Domain | Protein kinase | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 681_955 | 1020 | 1431.0 | Domain | Roc | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 13_275 | 1020 | 1431.0 | Domain | Protein kinase | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 681_955 | 1020 | 1431.0 | Domain | Roc | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 13_275 | 1020 | 1431.0 | Domain | Protein kinase | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 681_955 | 1020 | 1431.0 | Domain | Roc | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 19_27 | 1020 | 1431.0 | Nucleotide binding | Note=ATP | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 94_96 | 1020 | 1431.0 | Nucleotide binding | Note=ATP | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 19_27 | 1020 | 1431.0 | Nucleotide binding | Note=ATP | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 94_96 | 1020 | 1431.0 | Nucleotide binding | Note=ATP | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 19_27 | 1020 | 1431.0 | Nucleotide binding | Note=ATP | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 94_96 | 1020 | 1431.0 | Nucleotide binding | Note=ATP | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 267_334 | 1020 | 1431.0 | Region | Note=Calmodulin-binding | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 292_301 | 1020 | 1431.0 | Region | Autoinhibitory domain | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 267_334 | 1020 | 1431.0 | Region | Note=Calmodulin-binding | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 292_301 | 1020 | 1431.0 | Region | Autoinhibitory domain | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 267_334 | 1020 | 1431.0 | Region | Note=Calmodulin-binding | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 292_301 | 1020 | 1431.0 | Region | Autoinhibitory domain | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 378_407 | 1020 | 1431.0 | Repeat | Note=ANK 1 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 411_440 | 1020 | 1431.0 | Repeat | Note=ANK 2 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 444_473 | 1020 | 1431.0 | Repeat | Note=ANK 3 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 477_506 | 1020 | 1431.0 | Repeat | Note=ANK 4 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 510_539 | 1020 | 1431.0 | Repeat | Note=ANK 5 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 543_572 | 1020 | 1431.0 | Repeat | Note=ANK 6 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 576_605 | 1020 | 1431.0 | Repeat | Note=ANK 7 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 609_638 | 1020 | 1431.0 | Repeat | Note=ANK 8 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000358077 | 24 | 26 | 875_904 | 1020 | 1431.0 | Repeat | Note=ANK 9 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 378_407 | 1020 | 1431.0 | Repeat | Note=ANK 1 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 411_440 | 1020 | 1431.0 | Repeat | Note=ANK 2 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 444_473 | 1020 | 1431.0 | Repeat | Note=ANK 3 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 477_506 | 1020 | 1431.0 | Repeat | Note=ANK 4 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 510_539 | 1020 | 1431.0 | Repeat | Note=ANK 5 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 543_572 | 1020 | 1431.0 | Repeat | Note=ANK 6 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 576_605 | 1020 | 1431.0 | Repeat | Note=ANK 7 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 609_638 | 1020 | 1431.0 | Repeat | Note=ANK 8 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000408954 | 24 | 26 | 875_904 | 1020 | 1431.0 | Repeat | Note=ANK 9 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 378_407 | 1020 | 1431.0 | Repeat | Note=ANK 1 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 411_440 | 1020 | 1431.0 | Repeat | Note=ANK 2 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 444_473 | 1020 | 1431.0 | Repeat | Note=ANK 3 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 477_506 | 1020 | 1431.0 | Repeat | Note=ANK 4 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 510_539 | 1020 | 1431.0 | Repeat | Note=ANK 5 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 543_572 | 1020 | 1431.0 | Repeat | Note=ANK 6 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 576_605 | 1020 | 1431.0 | Repeat | Note=ANK 7 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 609_638 | 1020 | 1431.0 | Repeat | Note=ANK 8 | |
| Tgene | DAPK1 | chr13:95248305 | chr9:90321047 | ENST00000472284 | 24 | 26 | 875_904 | 1020 | 1431.0 | Repeat | Note=ANK 9 |
Top |
Fusion Gene Sequence for TGDS-DAPK1 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >90422_90422_1_TGDS-DAPK1_TGDS_chr13_95248305_ENST00000261296_DAPK1_chr9_90321047_ENST00000469640_length(transcript)=2709nt_BP=207nt GCCTCTGGCTGCTCTGTTAACGTGTCCCGCGAGCGAGGCGCGTCGCAAAAGGTCGCGGCGGAACTTCCCTGCGCTTTTCAGACCATACTC TTTACGGTACTAGGCACTGCTGAGCTGGGAGATGTCGGCGGCGTGTTGGGAGGAACCGTGGGGTCTTCCCGGCGGCTTTGCGAAGCGGGT CCTGGTGACCGGCGGTGCTGGTTTCATATCAACATCATGCAAAGTGAAACAGTTCAGGACGTGCTGCTCCTGGACCCCCGCTGGCTCTGC ACAAACGTCCTGGGGAAGTTGCTGTCCGTGGAGACCCCACGGGCGCTGCACCACTACCGGGGCCGCTACACCGTGGAGGACATCCAGCGC CTGGTGCCCGACAGCGACGTGGAGGAGCTGCTGCAGATCCTCGATGCCATGGACATCTGCGCCCGGGACCTGAGCAGCGGGACCATGGTG GACGTCCCAGCCCTGATCAAGACAGACAACCTGCACCGCTCCTGGGCTGATGAGGAGGACGAGGTGATGGTGTATGGTGGCGTGCGCATC GTGCCCGTGGAACACCTCACCCCCTTCCCATGTGGCATCTTTCACAAGGTCCAGGTGAACCTGTGCCGGTGGATCCACCAGCAAAGCACA GAGGGCGACGCGGACATCCGCCTGTGGGTGAATGGCTGCAAGCTGGCCAACCGTGGGGCCGAGCTGCTGGTGCTGCTGGTCAACCACGGC CAGGGCATTGAGGTCCAGGTCCGCGGCCTGGAGACGGAGAAGATCAAGTGCTGCCTGCTGCTGGACTCGGTGTGCAGCACCATTGAGAAC GTCATGGCCACCACGCTGCCAGGGCTCCTGACCGTGAAGCATTACCTGAGCCCCCAGCAGCTGCGGGAGCACCATGAGCCCGTCATGATC TACCAGCCACGGGACTTCTTCCGGGCACAGACTCTGAAGGAAACCTCACTGACCAACACCATGGGGGGGTACAAGGAAAGCTTCAGCAGC ATCATGTGCTTCGGGTGTCACGACGTCTACTCACAGGCCAGCCTCGGCATGGACATCCATGCATCAGACCTGAACCTCCTCACTCGGAGG AAACTGAGTCGCCTGCTGGACCCGCCCGACCCCCTGGGGAAGGACTGGTGCCTTCTCGCCATGAACTTAGGCCTCCCTGACCTCGTGGCA AAGTACAACACCAGTAACGGGGCTCCCAAGGATTTCCTCCCCAGCCCCCTCCACGCCCTGCTGCGGGAATGGACCACCTACCCTGAGAGC ACAGTGGGCACCCTCATGTCCAAACTGAGGGAGCTGGGTCGCCGGGATGCCGCAGACTTTTTGCTGAAGGCATCCTCTGTGTTCAAAATC AACCTGGATGGCAATGGCCAGGAGGCCTATGCCTCGAGCTGCAACAGCGGCACCTCTTACAATTCCATTAGCTCTGTTGTATCCCGGTGA GGGCAGCCTCTGGCTTGGGCAGGGTCTGTTTGGACTGCAGAAGCAAGGGGGTGATGTAGCCCATCCTTCCCTTTGGAGATGCTGAGGGTG TTTCTTCCTGCACCCACAGCCAGGGGGATGCCACTCCTCCCTCCGGCTTGACCTGTTTCTCTGCCGCTACCTCCCTCCCCGTCTCATTCC GTTGTCTGTGGATGGTCATTGCAGTTTAAGAGCAGAACAGATCTTTTACTTTGGCCGCTTGAAAAGCTAGTGTACCTCCTCTCAGTGTTT TGGACTCCATCTCTCATCCTCCAGTACCTTGCTTCTTACTGATAATTTTGCTGGAATTCCTAACTTTTCAATGACATTTTTTTTAACTAC TATATTGATTGTCCTTTAAAAAAGAAAAGTGCATATTTATCCAAAATGTGTATTTCTTATACGCTTTTCTTTGTTATACCATTTCCTCAG CTTATCTCTTTTATATTTGTAGGAGAAACTCCCATGTATGGAATCCCACTGTATGATTTATAAACAGACAATATGTGAGTGCCTTTTGCA GAAGAGGGTGTGTTTGAAATCATCGGAGTCAGCCAGGAGCTGTCACCAAGGAAACGCTACCTCTCTGTCCCTTGCTGTATGCTGATCATC GCCAGAGGTGCTTCACCCTGAGTTTTGTTTTGTATTGTTTTCTGACAGTTTTTCTGTTTTGTTTGGCAAGGAAAGGGGAGAAGGGAATCC TCCTCCAGGGTGATTTTATGATCAGTGTTGTTGCTCTAGGAAGACATTTTTCCGTTTGCTTTTGTTCCAATGTCAATGTGAACGTCCACA TGAAACCTACACACTGTCATGCTTCATCATTCCCTCTCATCTCAGGTAGAAGGTTGACACAGTTGTAGGGTTACAGAGACCTATGTAAGA ATTCAGAAGACCCCTGACTCATCATTTGTGGCAGTCCCTTATAATTGGTGCATAGCAGATGGTTTCCACATTTAGATCCTGGTTTCATAA CTTCCTGTACTTGAAGTCTAAAAGCAGAAAATAAAGGAAGCAAGTTTTCTTCCATGATTTTAAATTGTGATCGAGTTTTAAATTGATAGG AGGGAACATGTCCTAATTCTTCTGTCCTGAGAAGCATGTAATGTTAATGTTATATCATATGTATATATATATATGCACTATGTATATACA TATATATTAATACTGGTATTTTTACTTAATCTATAAAATGTCGTTAAAAAGTTGTTTGTTTTTTTCTTTTTTTATAAATAAACTGTTGCT >90422_90422_1_TGDS-DAPK1_TGDS_chr13_95248305_ENST00000261296_DAPK1_chr9_90321047_ENST00000469640_length(amino acids)=441AA_BP=31 MGDVGGVLGGTVGSSRRLCEAGPGDRRCWFHINIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVE ELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRL WVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFR AQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGA -------------------------------------------------------------- >90422_90422_2_TGDS-DAPK1_TGDS_chr13_95248305_ENST00000261296_DAPK1_chr9_90321047_ENST00000472284_length(transcript)=2706nt_BP=207nt GCCTCTGGCTGCTCTGTTAACGTGTCCCGCGAGCGAGGCGCGTCGCAAAAGGTCGCGGCGGAACTTCCCTGCGCTTTTCAGACCATACTC TTTACGGTACTAGGCACTGCTGAGCTGGGAGATGTCGGCGGCGTGTTGGGAGGAACCGTGGGGTCTTCCCGGCGGCTTTGCGAAGCGGGT CCTGGTGACCGGCGGTGCTGGTTTCATATCAACATCATGCAAAGTGAAACAGTTCAGGACGTGCTGCTCCTGGACCCCCGCTGGCTCTGC ACAAACGTCCTGGGGAAGTTGCTGTCCGTGGAGACCCCACGGGCGCTGCACCACTACCGGGGCCGCTACACCGTGGAGGACATCCAGCGC CTGGTGCCCGACAGCGACGTGGAGGAGCTGCTGCAGATCCTCGATGCCATGGACATCTGCGCCCGGGACCTGAGCAGCGGGACCATGGTG GACGTCCCAGCCCTGATCAAGACAGACAACCTGCACCGCTCCTGGGCTGATGAGGAGGACGAGGTGATGGTGTATGGTGGCGTGCGCATC GTGCCCGTGGAACACCTCACCCCCTTCCCATGTGGCATCTTTCACAAGGTCCAGGTGAACCTGTGCCGGTGGATCCACCAGCAAAGCACA GAGGGCGACGCGGACATCCGCCTGTGGGTGAATGGCTGCAAGCTGGCCAACCGTGGGGCCGAGCTGCTGGTGCTGCTGGTCAACCACGGC CAGGGCATTGAGGTCCAGGTCCGCGGCCTGGAGACGGAGAAGATCAAGTGCTGCCTGCTGCTGGACTCGGTGTGCAGCACCATTGAGAAC GTCATGGCCACCACGCTGCCAGGGCTCCTGACCGTGAAGCATTACCTGAGCCCCCAGCAGCTGCGGGAGCACCATGAGCCCGTCATGATC TACCAGCCACGGGACTTCTTCCGGGCACAGACTCTGAAGGAAACCTCACTGACCAACACCATGGGGGGGTACAAGGAAAGCTTCAGCAGC ATCATGTGCTTCGGGTGTCACGACGTCTACTCACAGGCCAGCCTCGGCATGGACATCCATGCATCAGACCTGAACCTCCTCACTCGGAGG AAACTGAGTCGCCTGCTGGACCCGCCCGACCCCCTGGGGAAGGACTGGTGCCTTCTCGCCATGAACTTAGGCCTCCCTGACCTCGTGGCA AAGTACAACACCAGTAACGGGGCTCCCAAGGATTTCCTCCCCAGCCCCCTCCACGCCCTGCTGCGGGAATGGACCACCTACCCTGAGAGC ACAGTGGGCACCCTCATGTCCAAACTGAGGGAGCTGGGTCGCCGGGATGCCGCAGACTTTTTGCTGAAGGCATCCTCTGTGTTCAAAATC AACCTGGATGGCAATGGCCAGGAGGCCTATGCCTCGAGCTGCAACAGCGGCACCTCTTACAATTCCATTAGCTCTGTTGTATCCCGGTGA GGGCAGCCTCTGGCTTGGGCAGGGTCTGTTTGGACTGCAGAAGCAAGGGGGTGATGTAGCCCATCCTTCCCTTTGGAGATGCTGAGGGTG TTTCTTCCTGCACCCACAGCCAGGGGGATGCCACTCCTCCCTCCGGCTTGACCTGTTTCTCTGCCGCTACCTCCCTCCCCGTCTCATTCC GTTGTCTGTGGATGGTCATTGCAGTTTAAGAGCAGAACAGATCTTTTACTTTGGCCGCTTGAAAAGCTAGTGTACCTCCTCTCAGTGTTT TGGACTCCATCTCTCATCCTCCAGTACCTTGCTTCTTACTGATAATTTTGCTGGAATTCCTAACTTTTCAATGACATTTTTTTTAACTAC TATATTGATTGTCCTTTAAAAAAGAAAAGTGCATATTTATCCAAAATGTGTATTTCTTATACGCTTTTCTTTGTTATACCATTTCCTCAG CTTATCTCTTTTATATTTGTAGGAGAAACTCCCATGTATGGAATCCCACTGTATGATTTATAAACAGACAATATGTGAGTGCCTTTTGCA GAAGAGGGTGTGTTTGAAATCATCGGAGTCAGCCAGGAGCTGTCACCAAGGAAACGCTACCTCTCTGTCCCTTGCTGTATGCTGATCATC GCCAGAGGTGCTTCACCCTGAGTTTTGTTTTGTATTGTTTTCTGACAGTTTTTCTGTTTTGTTTGGCAAGGAAAGGGGAGAAGGGAATCC TCCTCCAGGGTGATTTTATGATCAGTGTTGTTGCTCTAGGAAGACATTTTTCCGTTTGCTTTTGTTCCAATGTCAATGTGAACGTCCACA TGAAACCTACACACTGTCATGCTTCATCATTCCCTCTCATCTCAGGTAGAAGGTTGACACAGTTGTAGGGTTACAGAGACCTATGTAAGA ATTCAGAAGACCCCTGACTCATCATTTGTGGCAGTCCCTTATAATTGGTGCATAGCAGATGGTTTCCACATTTAGATCCTGGTTTCATAA CTTCCTGTACTTGAAGTCTAAAAGCAGAAAATAAAGGAAGCAAGTTTTCTTCCATGATTTTAAATTGTGATCGAGTTTTAAATTGATAGG AGGGAACATGTCCTAATTCTTCTGTCCTGAGAAGCATGTAATGTTAATGTTATATCATATGTATATATATATATGCACTATGTATATACA TATATATTAATACTGGTATTTTTACTTAATCTATAAAATGTCGTTAAAAAGTTGTTTGTTTTTTTCTTTTTTTATAAATAAACTGTTGCT >90422_90422_2_TGDS-DAPK1_TGDS_chr13_95248305_ENST00000261296_DAPK1_chr9_90321047_ENST00000472284_length(amino acids)=441AA_BP=31 MGDVGGVLGGTVGSSRRLCEAGPGDRRCWFHINIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVE ELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRL WVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFR AQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGA -------------------------------------------------------------- >90422_90422_3_TGDS-DAPK1_TGDS_chr13_95248305_ENST00000261296_DAPK1_chr9_90321047_ENST00000491893_length(transcript)=1458nt_BP=207nt GCCTCTGGCTGCTCTGTTAACGTGTCCCGCGAGCGAGGCGCGTCGCAAAAGGTCGCGGCGGAACTTCCCTGCGCTTTTCAGACCATACTC TTTACGGTACTAGGCACTGCTGAGCTGGGAGATGTCGGCGGCGTGTTGGGAGGAACCGTGGGGTCTTCCCGGCGGCTTTGCGAAGCGGGT CCTGGTGACCGGCGGTGCTGGTTTCATATCAACATCATGCAAAGTGAAACAGTTCAGGACGTGCTGCTCCTGGACCCCCGCTGGCTCTGC ACAAACGTCCTGGGGAAGTTGCTGTCCGTGGAGACCCCACGGGCGCTGCACCACTACCGGGGCCGCTACACCGTGGAGGACATCCAGCGC CTGGTGCCCGACAGCGACGTGGAGGAGCTGCTGCAGATCCTCGATGCCATGGACATCTGCGCCCGGGACCTGAGCAGCGGGACCATGGTG GACGTCCCAGCCCTGATCAAGACAGACAACCTGCACCGCTCCTGGGCTGATGAGGAGGACGAGGTGATGGTGTATGGTGGCGTGCGCATC GTGCCCGTGGAACACCTCACCCCCTTCCCATGTGGCATCTTTCACAAGGTCCAGGTGAACCTGTGCCGGTGGATCCACCAGCAAAGCACA GAGGGCGACGCGGACATCCGCCTGTGGGTGAATGGCTGCAAGCTGGCCAACCGTGGGGCCGAGCTGCTGGTGCTGCTGGTCAACCACGGC CAGGGCATTGAGGTCCAGGTCCGCGGCCTGGAGACGGAGAAGATCAAGTGCTGCCTGCTGCTGGACTCGGTGTGCAGCACCATTGAGAAC GTCATGGCCACCACGCTGCCAGGGCTCCTGACCGTGAAGCATTACCTGAGCCCCCAGCAGCTGCGGGAGCACCATGAGCCCGTCATGATC TACCAGCCACGGGACTTCTTCCGGGCACAGACTCTGAAGGAAACCTCACTGACCAACACCATGGGGGGGTACAAGGAAAGCTTCAGCAGC ATCATGTGCTTCGGGTGTCACGACGTCTACTCACAGGCCAGCCTCGGCATGGACATCCATGCATCAGACCTGAACCTCCTCACTCGGAGG AAACTGAGTCGCCTGCTGGACCCGCCCGACCCCCTGGGGAAGGACTGGTGCCTTCTCGCCATGAACTTAGGCCTCCCTGACCTCGTGGCA AAGTACAACACCAGTAACGGGGCTCCCAAGGATTTCCTCCCCAGCCCCCTCCACGCCCTGCTGCGGGAATGGACCACCTACCCTGAGAGC ACAGTGGGCACCCTCATGTCCAAACTGAGGGAGCTGGGTCGCCGGGATGCCGCAGACTTTTTGCTGAAGGCATCCTCTGTGTTCAAAATC AACCTGGATGGCAATGGCCAGGAGGCCTATGCCTCGAGCTGCAACAGCGGCACCTCTTACAATTCCATTAGCTCTGTTGTATCCCGGTGA >90422_90422_3_TGDS-DAPK1_TGDS_chr13_95248305_ENST00000261296_DAPK1_chr9_90321047_ENST00000491893_length(amino acids)=441AA_BP=31 MGDVGGVLGGTVGSSRRLCEAGPGDRRCWFHINIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVE ELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRL WVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFR AQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGA -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for TGDS-DAPK1 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for TGDS-DAPK1 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for TGDS-DAPK1 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies