FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

Fusion Gene Summary

leaf

Fusion Gene ORF analysis

leaf

Fusion Genomic Features

leaf

Fusion Protein Features

leaf

Fusion Gene Sequence

leaf

Fusion Gene PPI analysis

leaf

Related Drugs

leaf

Related Diseases

Fusion gene:UBE2R2-ATP5O (FusionGDB2 ID:96227)

Fusion Gene Summary for UBE2R2-ATP5O

check button Fusion gene summary
Fusion gene informationFusion gene name: UBE2R2-ATP5O
Fusion gene ID: 96227
HgeneTgene
Gene symbol

UBE2R2

ATP5O

Gene ID

54926

539

Gene nameubiquitin conjugating enzyme E2 R2ATP synthase peripheral stalk subunit OSCP
SynonymsCDC34B|E2-CDC34B|UBC3BATP5O|ATPO|HMC08D05|OSCP
Cytomap

9p13.3

21q22.11

Type of geneprotein-codingprotein-coding
Descriptionubiquitin-conjugating enzyme E2 R2E2 ubiquitin-conjugating enzyme R2ubiquitin carrier protein R2ubiquitin conjugating enzyme E2R 2ubiquitin-conjugating enzyme E2-CDC34Bubiquitin-conjugating enzyme UBC3Bubiquitin-protein ligase R2ATP synthase subunit O, mitochondrialATP synthase, H+ transporting, mitochondrial F1 complex, O subunithuman ATP synthase OSCP subunitoligomycin sensitivity conferral protein oscp-like proteinoligomycin sensitivity conferring protein
Modification date2020031320200313
UniProtAcc..
Ensembl transtripts involved in fusion geneENST00000263228, ENST00000496044, 
ENST00000290299, 
Fusion gene scores* DoF score16 X 11 X 7=12322 X 2 X 2=8
# samples 172
** MAII scorelog2(17/1232*10)=-2.8573956045572
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: UBE2R2 [Title/Abstract] AND ATP5O [Title/Abstract] AND fusion [Title/Abstract]

Most frequent breakpointUBE2R2(33817932)-ATP5O(35276325), # samples:1
Anticipated loss of major functional domain due to fusion event.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneUBE2R2

GO:0006513

protein monoubiquitination

20061386

HgeneUBE2R2

GO:0070936

protein K48-linked ubiquitination

20061386


check buttonFusion gene breakpoints across UBE2R2 (5'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
all structure

check buttonFusion gene breakpoints across ATP5O (3'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
all structure

check button Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
SourceDiseaseSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChimerDB4SARCTCGA-MO-A47P-01AUBE2R2chr9

33817932

+ATP5Ochr21

35276325

-


Top

Fusion Gene ORF analysis for UBE2R2-ATP5O

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5CDS-intronENST00000263228ENST00000496044UBE2R2chr9

33817932

+ATP5Ochr21

35276325

-
In-frameENST00000263228ENST00000290299UBE2R2chr9

33817932

+ATP5Ochr21

35276325

-

check buttonORFfinder result based on the fusion transcript sequence of in-frame fusion genes.
HenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrandSeq length
(transcript)
BP loci
(transcript)
Predicted start
(transcript)
Predicted stop
(transcript)
Seq length
(amino acids)
ENST00000263228UBE2R2chr933817932+ENST00000290299ATP5Ochr2135276325-642368149568139

check buttonDeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated.
HenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrandNo-coding scoreCoding score
ENST00000263228ENST00000290299UBE2R2chr933817932+ATP5Ochr2135276325-0.0205242690.9794757

Top

Fusion Genomic Features for UBE2R2-ATP5O


check buttonFusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints.
HgeneHchrHbpHstrandTgeneTchrTbpTstrand1-pp (fusion gene breakpoint)

check buttonDistribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page.
genomic feature

check buttonDistribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page.

Top

Fusion Protein Features for UBE2R2-ATP5O


check button Four levels of functional features of fusion genes
Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:33817932/chr21:35276325)
- FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels.
- How to search
1. Put your fusion gene symbol.
2. Press the tab key until there will be shown the breakpoint information filled.
4. Go down and press 'Search' tab twice.
4. Go down to have the hyperlink of the search result.
5. Click the hyperlink.
6. See the FGviewer result for your fusion gene.
FGviewer

check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
..
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}.FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page


* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUBE2R2chr9:33817932chr21:35276325ENST00000263228+15200_23859239.0Compositional biasNote=Asp/Glu-rich (acidic)
HgeneUBE2R2chr9:33817932chr21:35276325ENST00000263228+158_17459239.0DomainUBC core


Top

Fusion Gene Sequence for UBE2R2-ATP5O


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones.
>96227_96227_1_UBE2R2-ATP5O_UBE2R2_chr9_33817932_ENST00000263228_ATP5O_chr21_35276325_ENST00000290299_length(transcript)=642nt_BP=368nt
TCGTGTGTGAGGAGGACCCCGGGCGGGCCCACGGGCCGTGTGGGGCCTGGTCTGGCCCGCCGGGTGTGTGAAGACCGGGGCCCGGTGCTG
CCCGGCCGGAGGGCGAGCGGAGGGGAGGGGCCTGGTCCGGCCCGGCCGGTGCGTGAGGACTGGGGCCCGGGCCCGGCGCCGCCGCCGCCG
CCGCCGCCGCGATGGCCCAGCAGCAGATGACCAGCTCGCAGAAGGCCCTGATGCTCGAGCTGAAATCCCTGCAGGAGGAACCGGTGGAGG
GCTTCCGGATCACCCTGGTGGACGAGTCCGACCTCTACAACTGGGAGGTGGCCATCTTCGGACCCCCCAACACCCTCTACGAAGGCGGCT
ACTTCAAGCCTTTAGAAGAAGCCACACTCTCTGAATTAAAAACTGTCCTCAAGAGCTTCCTAAGTCAAGGCCAAGTATTGAAATTGGAGG
CTAAGACTGATCCGTCAATCTTGGGTGGAATGATTGTGCGCATTGGCGAGAAATATGTTGACATGTCTGTCAAGACCAAGATTCAGAAGC
TGGGCAGGGCTATGCGGGAGATTGTCTAAAAGTGTTGGTTTTCTGCCATCAGTGAAAATTCTTAAACTTGGAGCAACAATAAAAAGCTTC

>96227_96227_1_UBE2R2-ATP5O_UBE2R2_chr9_33817932_ENST00000263228_ATP5O_chr21_35276325_ENST00000290299_length(amino acids)=139AA_BP=71
MGPGPGAAAAAAAAMAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKPLEEATLSELKTVLKSF

--------------------------------------------------------------

Top

Fusion Gene PPI Analysis for UBE2R2-ATP5O


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page.


check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

Related Drugs for UBE2R2-ATP5O


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.8 2021-05-08)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

Related Diseases for UBE2R2-ATP5O


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource