| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Kinase Fusion Gene:CDC42BPA_KCNK1 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
| Kinase Fusion partner gene information | Kinase Fusion gene name: CDC42BPA_KCNK1 | KinaseFusionDB ID: KFG1008 | FusionGDB2.0 ID: KFG1008 | Hgene | Tgene | Gene symbol | CDC42BPA | KCNK1 | Gene ID | 8476 | 3775 | |
| Gene name | CDC42 binding protein kinase alpha | potassium two pore domain channel subfamily K member 1 | ||||||||||
| Synonyms | MRCK|MRCKA|MRCKalpha|PK428 | DPK|HOHO|K2P1|K2p1.1|KCNO1|TWIK-1|TWIK1 | ||||||||||
| Cytomap | 1q42.13 | 1q42.2 | ||||||||||
| Type of gene | protein-coding | protein-coding | ||||||||||
| Description | serine/threonine-protein kinase MRCK alphaCDC42 binding protein kinase alpha (DMPK-like)CDC42 binding protein kinase betamyotonic dystrophy kinase-related CDC42-binding protein kinase alphamyotonic dystrophy protein kinase-like alphaser-thr protein k | potassium channel subfamily K member 1inward rectifying potassium channel protein TWIK-1potassium channel K2P1potassium channel KCNO1potassium channel, two pore domain subfamily K, member 1potassium inwardly-rectifying channel, subfamily K, member 1 | ||||||||||
| Modification date | 20240403 | 20240305 | ||||||||||
| UniProtAcc | Q5VT25 | O00180 | ||||||||||
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000334218, ENST00000366764, ENST00000366765, ENST00000366766, ENST00000366767, ENST00000366769, ENST00000535525, ENST00000488131, | ENST00000366620, ENST00000472190, ENST00000366621, | |||||||||
| Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: CDC42BPA [Title/Abstract] AND KCNK1 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CDC42BPA(227259909)-KCNK1(233802341), # samples:1 | |||||||||||
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | CDC42BPA | GO:0006468 | protein phosphorylation | 9092543 |
| Hgene | CDC42BPA | GO:0030036 | actin cytoskeleton organization | 9418861 |
| Tgene | KCNK1 | GO:0035725 | sodium ion transmembrane transport | 21653227 |
| Tgene | KCNK1 | GO:0071805 | potassium ion transmembrane transport | 21653227|22282804 |
Kinase Fusion gene breakpoints across CDC42BPA (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across KCNK1 (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
| ChimerDB4 | TCGA-CD-5799-01A | CDC42BPA | chr1 | 227259909 | KCNK1 | chr1 | 233802341 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
| ENST00000366767 | ENST00000366621 | CDC42BPA | chr1 | 227259909 | KCNK1 | chr1 | 233802341 | 4222 | 1079 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000366767_ENST00000366621_CDC42BPA_chr1_227259909_KCNK1_chr1_233802341_length(amino acids)=1079 MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGE VAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARF YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGV CMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIP EVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKR LEQEKLELSRKLQESTQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTL QQEREDLNKLEVHTEALAAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEELSKREGIH ANEIKNLKKELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLE EEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIR AKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRIT VHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKI -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genesGo to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:227259909/chr1:233802341) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| CDC42BPA | KCNK1 |
| FUNCTION: Serine/threonine-protein kinase which is an important downstream effector of CDC42 and plays a role in the regulation of cytoskeleton reorganization and cell migration (PubMed:15723050, PubMed:9418861, PubMed:9092543). Regulates actin cytoskeletal reorganization via phosphorylation of PPP1R12C and MYL9/MLC2 (PubMed:21457715). In concert with MYO18A and LURAP1, is involved in modulating lamellar actomyosin retrograde flow that is crucial to cell protrusion and migration (PubMed:18854160). Phosphorylates: PPP1R12A, LIMK1 and LIMK2 (PubMed:11340065, PubMed:11399775). May play a role in TFRC-mediated iron uptake (PubMed:20188707). In concert with FAM89B/LRAP25 mediates the targeting of LIMK1 to the lamellipodium resulting in its activation and subsequent phosphorylation of CFL1 which is important for lamellipodial F-actin regulation (By similarity). Triggers the formation of an extrusion apical actin ring required for epithelial extrusion of apoptotic cells (PubMed:29162624). {ECO:0000250|UniProtKB:Q3UU96, ECO:0000269|PubMed:11340065, ECO:0000269|PubMed:11399775, ECO:0000269|PubMed:15723050, ECO:0000269|PubMed:18854160, ECO:0000269|PubMed:20188707, ECO:0000269|PubMed:21457715, ECO:0000269|PubMed:29162624, ECO:0000269|PubMed:9092543, ECO:0000269|PubMed:9418861}. | FUNCTION: Ion channel that contributes to passive transmembrane potassium transport and to the regulation of the resting membrane potential in brain astrocytes, but also in kidney and in other tissues (PubMed:15820677, PubMed:21653227). Forms dimeric channels through which potassium ions pass in accordance with their electrochemical gradient. The channel is selective for K(+) ions at physiological potassium concentrations and at neutral pH, but becomes permeable to Na(+) at subphysiological K(+) levels and upon acidification of the extracellular medium (PubMed:21653227, PubMed:22431633). The homodimer has very low potassium channel activity, when expressed in heterologous systems, and can function as weakly inward rectifying potassium channel (PubMed:8605869, PubMed:8978667, PubMed:15820677, PubMed:21653227, PubMed:22431633, PubMed:23169818, PubMed:25001086). Channel activity is modulated by activation of serotonin receptors (By similarity). Heterodimeric channels containing KCNK1 and KCNK2 have much higher activity, and may represent the predominant form in astrocytes (By similarity). Heterodimeric channels containing KCNK1 and KCNK3 or KCNK9 have much higher activity (PubMed:23169818). Heterodimeric channels formed by KCNK1 and KCNK9 may contribute to halothane-sensitive currents (PubMed:23169818). Mediates outward rectifying potassium currents in dentate gyrus granule cells and contributes to the regulation of their resting membrane potential (By similarity). Contributes to the regulation of action potential firing in dentate gyrus granule cells and down-regulates their intrinsic excitability (By similarity). In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1 (By similarity). Required for normal ion and water transport in the kidney (By similarity). Contributes to the regulation of the resting membrane potential of pancreatic beta cells (By similarity). The low channel activity of homodimeric KCNK1 may be due to sumoylation (PubMed:15820677, PubMed:20498050, PubMed:23169818). The low channel activity may be due to rapid internalization from the cell membrane and retention in recycling endosomes (PubMed:19959478). {ECO:0000250|UniProtKB:O08581, ECO:0000250|UniProtKB:Q9Z2T2, ECO:0000269|PubMed:15820677, ECO:0000269|PubMed:17693262, ECO:0000269|PubMed:19959478, ECO:0000269|PubMed:20498050, ECO:0000269|PubMed:21653227, ECO:0000269|PubMed:22282804, ECO:0000269|PubMed:22431633, ECO:0000269|PubMed:23169818, ECO:0000269|PubMed:25001086, ECO:0000269|PubMed:8605869, ECO:0000269|PubMed:8978667}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
| Hgene | CDC42BPA | 227259909 | KCNK1 | 233802341 | ENST00000366767 | 19 | 35 | 344_414 | 8611 | 1639 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
| Hgene | CDC42BPA | 227259909 | KCNK1 | 233802341 | ENST00000366767 | 20 | 35 | 344_414 | 9421 | 1692 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
| Hgene | CDC42BPA | 227259909 | KCNK1 | 233802341 | ENST00000366767 | 20 | 36 | 344_414 | 9421 | 1720 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
| Hgene | CDC42BPA | 227259909 | KCNK1 | 233802341 | ENST00000366767 | 20 | 37 | 344_414 | 9421 | 1733 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
| Hgene | CDC42BPA | 227259909 | KCNK1 | 233802341 | ENST00000366767 | 20 | 37 | 344_414 | 9421 | 1755 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
| Hgene | CDC42BPA | 227259909 | KCNK1 | 233802341 | ENST00000366767 | 20 | 37 | 344_414 | 9421 | 1782 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
| Hgene | CDC42BPA | 227259909 | KCNK1 | 233802341 | ENST00000366767 | 19 | 35 | 77_343 | 8611 | 1639 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255,ECO:0000269;evidence=ECO:0000255|PROSITE-ProRule:PRU00159,ECO:0000269|PubMed:9092543;Dbxref=PMID:9092543 |
| Hgene | CDC42BPA | 227259909 | KCNK1 | 233802341 | ENST00000366767 | 20 | 35 | 77_343 | 9421 | 1692 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255,ECO:0000269;evidence=ECO:0000255|PROSITE-ProRule:PRU00159,ECO:0000269|PubMed:9092543;Dbxref=PMID:9092543 |
| Hgene | CDC42BPA | 227259909 | KCNK1 | 233802341 | ENST00000366767 | 20 | 36 | 77_343 | 9421 | 1720 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255,ECO:0000269;evidence=ECO:0000255|PROSITE-ProRule:PRU00159,ECO:0000269|PubMed:9092543;Dbxref=PMID:9092543 |
| Hgene | CDC42BPA | 227259909 | KCNK1 | 233802341 | ENST00000366767 | 20 | 37 | 77_343 | 9421 | 1733 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255,ECO:0000269;evidence=ECO:0000255|PROSITE-ProRule:PRU00159,ECO:0000269|PubMed:9092543;Dbxref=PMID:9092543 |
| Hgene | CDC42BPA | 227259909 | KCNK1 | 233802341 | ENST00000366767 | 20 | 37 | 77_343 | 9421 | 1755 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255,ECO:0000269;evidence=ECO:0000255|PROSITE-ProRule:PRU00159,ECO:0000269|PubMed:9092543;Dbxref=PMID:9092543 |
| Hgene | CDC42BPA | 227259909 | KCNK1 | 233802341 | ENST00000366767 | 20 | 37 | 77_343 | 9421 | 1782 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255,ECO:0000269;evidence=ECO:0000255|PROSITE-ProRule:PRU00159,ECO:0000269|PubMed:9092543;Dbxref=PMID:9092543 |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
| PDB file >>>56_CDC42BPA_KCNK1 | ENST00000366767 | ENST00000366621 | CDC42BPA | chr1 | 227259909 | KCNK1 | chr1 | 233802341 | MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGE VAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARF YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGV CMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIP EVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKR LEQEKLELSRKLQESTQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTL QQEREDLNKLEVHTEALAAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEELSKREGIH ANEIKNLKKELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLE EEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIR AKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRIT VHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKI | 1079 |
| 3D view using mol* of 56_CDC42BPA_KCNK1 | ||||||||||
| PDB file >>>HKFP_80_CDC42BPA_KCNK1 | ENST00000366767 | ENST00000366621 | CDC42BPA | chr1 | 227259909 | KCNK1 | chr1 | 233802341 | MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGE VAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARF YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGV CMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIP EVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKR LEQEKLELSRKLQESTQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTL QQEREDLNKLEVHTEALAAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEELSKREGIH ANEIKNLKKELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLE EEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIR AKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRIT VHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKI | 1079_CDC42BPA_KCNK1 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
| 56_CDC42BPA_KCNK1.png |
![]() |
| 56_CDC42BPA_KCNK1.png |
![]() |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
| Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| 56_CDC42BPA_KCNK1_ramachandran.png |
![]() |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors.Distribution of the number of occurrence across all approved kinase inhibitors. |
| 5'-kinase fusion protein case |
![]() |
| 3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules.* The detailed information of individual kinase inhibitors are available in the download page. |
| Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Ruxolitinib | -7.634189999999999 | -7.634189999999999 | -37.9215 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Afatinib | -6.705439999999999 | -6.887739999999999 | -53.1808 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Afatinib | -6.705439999999999 | -6.887739999999999 | -53.1808 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Afatinib | -6.704039999999999 | -6.887739999999999 | -53.1808 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Lapatinib | -6.65683 | -6.74563 | -59.4664 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Lapatinib | -6.53746 | -6.62626 | -57.9196 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Mobocertinib | -6.51587 | -6.523569999999999 | -64.1996 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Crizotinib | -6.50421 | -7.00011 | -45.9076 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Crizotinib | -6.50421 | -7.00011 | -45.9076 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Sunitinib | -6.444030000000001 | -6.448230000000001 | -43.3854 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Tepotinib | -6.32394 | -6.32504 | -52.4447 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Netarsudil | -6.26892 | -6.2800199999999995 | -48.3007 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Netarsudil | -6.26892 | -6.2800199999999995 | -48.3007 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Imatinib | -6.20616 | -6.41276 | -54.9291 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Imatinib | -6.20616 | -6.41276 | -54.9291 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Imatinib | -6.20616 | -6.41276 | -54.9291 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Crizotinib | -6.18032 | -6.51652 | -42.0356 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Crizotinib | -6.18032 | -6.51652 | -42.0356 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Sunitinib | -6.15995 | -6.16415 | -44.2617 |
| 56_CDC42BPA_KCNK1-DOCK_HTVS_1-001 | Tofacitinib | -6.1596 | -6.1711 | -36.9558 |
Top |
Kinase-Substrate Information of CDC42BPA_KCNK1 |
Phosphorylation target of the kinase(phosphosite, 03-17-2024) |
| Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
| CDC42BPA | Q5VT25 | human | CDC42BPA | Q5VT25 | T403 | HLPFVGFtYTSSCVL | Pkinase_C |
| CDC42BPA | Q5VT25 | human | CDC42BPA | Q5VT25 | S1003 | RKKGCPGsTGFPPKR | |
| CDC42BPA | Q5VT25 | human | CDC42BPA | Q5VT25 | T240 | QsSVAVGtPDYISPE | Pkinase |
| CDC42BPA | Q5VT25 | human | MYL9 | P24844 | S20 | KRPQRAtsNVFAMFD | |
| CDC42BPA | Q5VT25 | human | CDC42BPA | Q5VT25 | S234 | MEDGTVQsSVAVGtP | Pkinase |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
| Kinase | GOID | GO term | P.adjust |
| CDC42BPA | ID | Description | 0.00e+00 |
| CDC42BPA | GO:0031032 | actomyosin structure organization | 2.66e-03 |
| CDC42BPA | GO:0030239 | myofibril assembly | 3.43e-02 |
| CDC42BPA | GO:0070527 | platelet aggregation | 3.43e-02 |
| CDC42BPA | GO:0055002 | striated muscle cell development | 3.43e-02 |
| CDC42BPA | GO:0034109 | homotypic cell-cell adhesion | 3.43e-02 |
| CDC42BPA | GO:0018107 | peptidyl-threonine phosphorylation | 3.43e-02 |
| CDC42BPA | GO:0018210 | peptidyl-threonine modification | 3.43e-02 |
| CDC42BPA | GO:0010927 | cellular component assembly involved in morphogenesis | 3.43e-02 |
| CDC42BPA | GO:0030168 | platelet activation | 3.43e-02 |
| CDC42BPA | GO:0006937 | regulation of muscle contraction | 3.81e-02 |
| CDC42BPA | GO:0055001 | muscle cell development | 3.81e-02 |
| CDC42BPA | GO:0007596 | blood coagulation | 3.81e-02 |
| CDC42BPA | GO:0050817 | coagulation | 3.81e-02 |
| CDC42BPA | GO:0007599 | hemostasis | 3.81e-02 |
| CDC42BPA | GO:0090257 | regulation of muscle system process | 3.81e-02 |
| CDC42BPA | GO:0051146 | striated muscle cell differentiation | 4.41e-02 |
| CDC42BPA | GO:0006936 | muscle contraction | 4.64e-02 |
| CDC42BPA | GO:0050878 | regulation of body fluid levels | 4.64e-02 |
| CDC42BPA | GO:0140694 | non-membrane-bounded organelle assembly | 4.64e-02 |
| CDC42BPA | GO:0042692 | muscle cell differentiation | 4.64e-02 |
| CDC42BPA | GO:0042060 | wound healing | 4.64e-02 |
| CDC42BPA | GO:0003012 | muscle system process | 4.73e-02 |
Top |
Related Drugs to CDC42BPA_KCNK1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning CDC42BPA-KCNK1 and kinase inhibitors the PubMed Abstract (04-01-2024) |
| Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to CDC42BPA_KCNK1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
| MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
| Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |