UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:CNGA1_TXK |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: CNGA1_TXK | KinaseFusionDB ID: KFG1366 | FusionGDB2.0 ID: KFG1366 | Hgene | Tgene | Gene symbol | CNGA1 | TXK | Gene ID | 1259 | 7294 | |
Gene name | cyclic nucleotide gated channel subunit alpha 1 | TXK tyrosine kinase | ||||||||||
Synonyms | CNCG|CNCG1|CNG-1|CNG1|RCNC1|RCNCa|RCNCalpha|RP49 | BTKL|PSCTK5|PTK4|RLK|TKL | ||||||||||
Cytomap | 4p12 | 4p12 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | cGMP-gated cation channel alpha-1CNG channel alpha-1cyclic nucleotide gated channel alpha 1cyclic nucleotide-gated cation channel 1cyclic nucleotide-gated channel, photoreceptorinterleukin-1 homologuerod photoreceptor cGMP-gated channel subunit alph | tyrosine-protein kinase TXKPTK4 protein tyrosine kinase 4protein-tyrosine kinase 4resting lymphocyte kinase | ||||||||||
Modification date | 20240413 | 20240411 | ||||||||||
UniProtAcc | P29973 | P42681 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000402813, ENST00000514170, ENST00000358519, ENST00000544810, ENST00000420489, | ENST00000264316, ENST00000510457, ENST00000507351, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: CNGA1 [Title/Abstract] AND TXK [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | TXK | GO:0006468 | protein phosphorylation | 17177976 |
Tgene | TXK | GO:0010468 | regulation of gene expression | 11859127 |
Tgene | TXK | GO:0032729 | positive regulation of type II interferon production | 10523612|11859127 |
Tgene | TXK | GO:0045944 | positive regulation of transcription by RNA polymerase II | 11859127 |
Tgene | TXK | GO:0046777 | protein autophosphorylation | 12081135|17177976 |
Tgene | TXK | GO:0060335 | positive regulation of type II interferon-mediated signaling pathway | 11859127 |
Kinase Fusion gene breakpoints across CNGA1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across TXK (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
CCLE | HARA | CNGA1 | chr4 | 48018500 | TXK | chr4 | 48106972 |
CCLE | GB2 | CNGA1 | chr4 | 47944058 | TXK | chr4 | 48112620 |
CCLE | GB2 | CNGA1 | chr4 | 47945198 | TXK | chr4 | 48112620 |
CCLE | GB2 | CNGA1 | chr4 | 47944058 | TXK | chr4 | 48106972 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000358519 | ENST00000264316 | CNGA1 | chr4 | 47944058 | TXK | chr4 | 48112620 | 3117 | 586 |
ENST00000358519 | ENST00000264316 | CNGA1 | chr4 | 47945198 | TXK | chr4 | 48112620 | 3009 | 550 |
ENST00000358519 | ENST00000264316 | CNGA1 | chr4 | 47944058 | TXK | chr4 | 48106972 | 3051 | 564 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000358519_ENST00000264316_CNGA1_chr4_47944058_TXK_chr4_48112620_length(amino acids)=586 MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENPHARGSFSYKSLRKGGPSQREQYLPGAIALF NVNNSSNKDQEPEEKKKKKKEKKSKSDDKNENKNDPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNW TMVIARNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSG QWYVAERHAFQSIPELIWYHQHNAAGLMTRLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKAI NEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDL AARNCLVSSTCIVKISDFGMTRYVLDDEYVSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISE -------------------------------------------------------------- >ENST00000358519_ENST00000264316_CNGA1_chr4_47945198_TXK_chr4_48112620_length(amino acids)=550 MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENPHARGSFSYKSLRKGGPSQREQYLPGAIALF NVNNSSNKDQEPEEKKKKKKEKKSKSDDKNENKNDPEKKKKKKDKEKKKKEEKSKDKKEENEGLIPSNYVTENKITNLEIYEWYHRNITR NQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMTRLRYPVG LMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKAINEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRK PLYIVTEFMENGCLLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEYVSSFGAK FPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISEGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELL -------------------------------------------------------------- >ENST00000358519_ENST00000264316_CNGA1_chr4_47944058_TXK_chr4_48106972_length(amino acids)=564 MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENPHARGSFSYKSLRKGGPSQREQYLPGAIALF NVNNSSNKDQEPEEKKKKKKEKKSKSDDKNENKNDPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNW TMVIARWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQH NAAGLMTRLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKAINEGSMSEEDFIEEAKVMMKLSH SKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTR YVLDDEYVSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISEGFRLYRPHLAPMSIYEVMYSCW -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr4:/chr4:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
CNGA1 | TXK |
FUNCTION: Subunit of the rod cyclic GMP-gated cation channel, which is involved in the final stage of the phototransduction pathway. When light hits rod photoreceptors, cGMP concentrations decrease causing rapid closure of CNGA1/CNGB1 channels and, therefore, hyperpolarization of the membrane potential. {ECO:0000250|UniProtKB:Q00194}. | FUNCTION: Non-receptor tyrosine kinase that plays a redundant role with ITK in regulation of the adaptive immune response. Regulates the development, function and differentiation of conventional T-cells and nonconventional NKT-cells. When antigen presenting cells (APC) activate T-cell receptor (TCR), a series of phosphorylation leads to the recruitment of TXK to the cell membrane, where it is phosphorylated at Tyr-420. Phosphorylation leads to TXK full activation. Contributes also to signaling from many receptors and participates in multiple downstream pathways, including regulation of the actin cytoskeleton. Like ITK, can phosphorylate PLCG1, leading to its localization in lipid rafts and activation, followed by subsequent cleavage of its substrates. In turn, the endoplasmic reticulum releases calcium in the cytoplasm and the nuclear activator of activated T-cells (NFAT) translocates into the nucleus to perform its transcriptional duty. Plays a role in the positive regulation of IFNG transcription in T-helper 1 cells as part of an IFNG promoter-binding complex with PARP1 and EEF1A1 (PubMed:11859127, PubMed:17177976). Within the complex, phosphorylates both PARP1 and EEF1A1 (PubMed:17177976). Phosphorylates also key sites in LCP2 leading to the up-regulation of Th1 preferred cytokine IL-2. Phosphorylates 'Tyr-201' of CTLA4 which leads to the association of PI-3 kinase with the CTLA4 receptor. {ECO:0000269|PubMed:10523612, ECO:0000269|PubMed:11564877, ECO:0000269|PubMed:11859127, ECO:0000269|PubMed:17177976, ECO:0000269|PubMed:9813138}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | CNGA1 | 47944058 | TXK | 48106972 | ENST00000358519 | 4 | 15 | 271_527 | 148 | 528 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | CNGA1 | 47944058 | TXK | 48112620 | ENST00000358519 | 3 | 15 | 271_527 | 126 | 528 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | CNGA1 | 47945198 | TXK | 48112620 | ENST00000358519 | 3 | 15 | 271_527 | 126 | 528 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | CNGA1 | 47944058 | TXK | 48106972 | ENST00000358519 | 4 | 15 | 150_246 | 148 | 528 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Tgene | CNGA1 | 47944058 | TXK | 48112620 | ENST00000358519 | 3 | 15 | 150_246 | 126 | 528 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Tgene | CNGA1 | 47945198 | TXK | 48112620 | ENST00000358519 | 3 | 15 | 150_246 | 126 | 528 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>113_CNGA1_TXK | ENST00000358519 | ENST00000264316 | CNGA1 | chr4 | 47944058 | TXK | chr4 | 48106972 | MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENPHARGSFSYKSLRKGGPSQREQYLPGAIALF NVNNSSNKDQEPEEKKKKKKEKKSKSDDKNENKNDPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNW TMVIARWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQH NAAGLMTRLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKAINEGSMSEEDFIEEAKVMMKLSH SKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTR YVLDDEYVSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISEGFRLYRPHLAPMSIYEVMYSCW | 564 |
3D view using mol* of 113_CNGA1_TXK | ||||||||||
PDB file >>>TKFP_191_CNGA1_TXK | ENST00000358519 | ENST00000264316 | CNGA1 | chr4 | 47944058 | TXK | chr4 | 48112620 | MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENPHARGSFSYKSLRKGGPSQREQYLPGAIALF NVNNSSNKDQEPEEKKKKKKEKKSKSDDKNENKNDPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNW TMVIARNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSG QWYVAERHAFQSIPELIWYHQHNAAGLMTRLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKAI NEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDL AARNCLVSSTCIVKISDFGMTRYVLDDEYVSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISE | 586_CNGA1_TXK |
PDB file >>>TKFP_192_CNGA1_TXK | ENST00000358519 | ENST00000264316 | CNGA1 | chr4 | 47945198 | TXK | chr4 | 48112620 | MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENPHARGSFSYKSLRKGGPSQREQYLPGAIALF NVNNSSNKDQEPEEKKKKKKEKKSKSDDKNENKNDPEKKKKKKDKEKKKKEEKSKDKKEENEGLIPSNYVTENKITNLEIYEWYHRNITR NQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMTRLRYPVG LMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKAINEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRK PLYIVTEFMENGCLLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEYVSSFGAK FPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISEGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELL | 550_CNGA1_TXK |
3D view using mol* of TKFP_192_CNGA1_TXK | ||||||||||
PDB file >>>TKFP_193_CNGA1_TXK | ENST00000358519 | ENST00000264316 | CNGA1 | chr4 | 47944058 | TXK | chr4 | 48106972 | MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENPHARGSFSYKSLRKGGPSQREQYLPGAIALF NVNNSSNKDQEPEEKKKKKKEKKSKSDDKNENKNDPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNW TMVIARWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQH NAAGLMTRLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKAINEGSMSEEDFIEEAKVMMKLSH SKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTR YVLDDEYVSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISEGFRLYRPHLAPMSIYEVMYSCW | 564_CNGA1_TXK |
3D view using mol* of TKFP_193_CNGA1_TXK | ||||||||||
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
./secondary_str/TKFP_191_CNGA1_TXK_vs_TKFP_192_CNGA1_TXK.png |
./secondary_str/TKFP_193_CNGA1_TXK_vs_TKFP_191_CNGA1_TXK.png |
./secondary_str/TKFP_193_CNGA1_TXK_vs_TKFP_192_CNGA1_TXK.png |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
113_CNGA1_TXK.png |
113_CNGA1_TXK.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
113_CNGA1_TXK_ramachandran.png |
TKFP_192_CNGA1_TXK_ramachandran.png |
TKFP_193_CNGA1_TXK_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Avapritinib | -7.46323 | -7.79453 | -47.1223 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Avapritinib | -7.46323 | -7.79453 | -47.1223 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Avapritinib | -7.46323 | -7.79453 | -47.1223 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Avapritinib | -7.46323 | -7.79453 | -47.1223 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Selpercatinib | -6.82989 | -6.86039 | -54.0956 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Lapatinib | -6.70061 | -6.78941 | -59.0095 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Ponatinib | -6.3156 | -6.5222 | -36.8796 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Ponatinib | -6.3156 | -6.5222 | -36.8796 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Ponatinib | -6.3156 | -6.5222 | -36.8796 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Lapatinib | -6.20104 | -6.28984 | -52.7944 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Lapatinib | -6.13644 | -7.3048399999999996 | -62.5096 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Lapatinib | -6.13644 | -7.3048399999999996 | -62.5096 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Midostaurin | -6.09185 | -6.09185 | -25.9118 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Larotrectinib | -6.037669999999999 | -6.037669999999999 | -49.6817 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Selpercatinib | -6.014390000000001 | -6.0448900000000005 | -50.7249 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Selpercatinib | -6.014390000000001 | -6.0448900000000005 | -50.7249 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Palbociclib | -6.00157 | -6.4084699999999994 | -37.6435 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Futibatinib | -5.99408 | -5.99408 | -42.736999999999995 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Nilotinib | -5.93133 | -6.85613 | -42.9542 |
113_CNGA1_TXK-DOCK_HTVS_1-001 | Nilotinib | -5.93133 | -6.85613 | -42.9542 |
Top |
Kinase-Substrate Information of CNGA1_TXK |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
TXK | P42681 | human | TXK | P42681 | Y420 | RYVLDDEyVSSFGAK | PK_Tyr_Ser-Thr |
TXK | P42681 | human | TXK | P42681 | Y91 | KIQVKALyDFLPREP | SH3_1 |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
TXK | ID | Description | 0.00e+00 |
TXK | GO:0060330 | regulation of response to type II interferon | 1.16e-02 |
TXK | GO:0060334 | regulation of type II interferon-mediated signaling pathway | 1.16e-02 |
TXK | GO:0060333 | type II interferon-mediated signaling pathway | 1.16e-02 |
TXK | GO:0007202 | activation of phospholipase C activity | 1.16e-02 |
TXK | GO:0010863 | positive regulation of phospholipase C activity | 1.16e-02 |
TXK | GO:1900274 | regulation of phospholipase C activity | 1.16e-02 |
TXK | GO:0010518 | positive regulation of phospholipase activity | 1.16e-02 |
TXK | GO:0010543 | regulation of platelet activation | 1.16e-02 |
TXK | GO:0010517 | regulation of phospholipase activity | 1.16e-02 |
TXK | GO:0001961 | positive regulation of cytokine-mediated signaling pathway | 1.16e-02 |
TXK | GO:0060193 | positive regulation of lipase activity | 1.16e-02 |
TXK | GO:0060760 | positive regulation of response to cytokine stimulus | 1.16e-02 |
TXK | GO:0042246 | tissue regeneration | 1.16e-02 |
TXK | GO:0032729 | positive regulation of type II interferon production | 1.16e-02 |
TXK | GO:0060191 | regulation of lipase activity | 1.16e-02 |
TXK | GO:0140888 | interferon-mediated signaling pathway | 1.34e-02 |
TXK | GO:0007229 | integrin-mediated signaling pathway | 1.34e-02 |
TXK | GO:0032609 | type II interferon production | 1.34e-02 |
TXK | GO:0032649 | regulation of type II interferon production | 1.34e-02 |
TXK | GO:0071346 | cellular response to type II interferon | 1.34e-02 |
TXK | GO:0030168 | platelet activation | 1.39e-02 |
TXK | GO:0034341 | response to type II interferon | 1.39e-02 |
TXK | GO:0050852 | T cell receptor signaling pathway | 1.39e-02 |
TXK | GO:0001959 | regulation of cytokine-mediated signaling pathway | 1.59e-02 |
TXK | GO:0060759 | regulation of response to cytokine stimulus | 1.63e-02 |
TXK | GO:0031099 | regeneration | 1.63e-02 |
TXK | GO:0046777 | protein autophosphorylation | 1.63e-02 |
TXK | GO:0050851 | antigen receptor-mediated signaling pathway | 1.63e-02 |
TXK | GO:0007596 | blood coagulation | 1.66e-02 |
TXK | GO:0050817 | coagulation | 1.66e-02 |
TXK | GO:0007599 | hemostasis | 1.66e-02 |
TXK | GO:0002429 | immune response-activating cell surface receptor signaling pathway | 2.21e-02 |
TXK | GO:0045089 | positive regulation of innate immune response | 2.27e-02 |
TXK | GO:0002768 | immune response-regulating cell surface receptor signaling pathway | 2.27e-02 |
TXK | GO:0050878 | regulation of body fluid levels | 2.28e-02 |
TXK | GO:0002833 | positive regulation of response to biotic stimulus | 2.28e-02 |
TXK | GO:0042060 | wound healing | 2.49e-02 |
TXK | GO:0045088 | regulation of innate immune response | 2.49e-02 |
TXK | GO:0002757 | immune response-activating signaling pathway | 2.65e-02 |
TXK | GO:0031349 | positive regulation of defense response | 2.65e-02 |
TXK | GO:0001819 | positive regulation of cytokine production | 2.65e-02 |
TXK | GO:0002764 | immune response-regulating signaling pathway | 2.65e-02 |
Top |
Related Drugs to CNGA1_TXK |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning CNGA1-TXK and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to CNGA1_TXK |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |