UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:CPQ_PRKDC |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: CPQ_PRKDC | KinaseFusionDB ID: KFG1424 | FusionGDB2.0 ID: KFG1424 | Hgene | Tgene | Gene symbol | CPQ | PRKDC | Gene ID | 10404 | 5591 | |
Gene name | carboxypeptidase Q | protein kinase, DNA-activated, catalytic subunit | ||||||||||
Synonyms | LDP|PGCP | DNA-PKC|DNA-PKcs|DNAPK|DNAPKc|DNPK1|HYRC|HYRC1|IMD26|XRCC7|p350 | ||||||||||
Cytomap | 8q22.1 | 8q11.21 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | carboxypeptidase QSer-Met dipeptidaseaminopeptidaseblood plasma glutamate carboxypeptidaselysosomal dipeptidase | DNA-dependent protein kinase catalytic subunitDNA-PK catalytic subunithyper-radiosensitivity of murine scid mutation, complementing 1p460protein kinase, DNA-activated, catalytic polypeptide | ||||||||||
Modification date | 20240305 | 20240411 | ||||||||||
UniProtAcc | Q9Y646 | P78527 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000220763, ENST00000529551, | ENST00000338368, ENST00000314191, ENST00000523565, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: CPQ [Title/Abstract] AND PRKDC [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CPQ | GO:0006508 | proteolysis | 10206990 |
Hgene | CPQ | GO:0043171 | peptide catabolic process | 10206990 |
Tgene | PRKDC | GO:0000460 | maturation of 5.8S rRNA | 32103174 |
Tgene | PRKDC | GO:0002218 | activation of innate immune response | 28712728 |
Tgene | PRKDC | GO:0006468 | protein phosphorylation | 26237645 |
Tgene | PRKDC | GO:0006974 | DNA damage response | 26237645|29478807|35460603 |
Tgene | PRKDC | GO:0018105 | peptidyl-serine phosphorylation | 15194694 |
Tgene | PRKDC | GO:0018105 | peptidyl-serine phosphorylation | 19303849|32103174 |
Tgene | PRKDC | GO:0018107 | peptidyl-threonine phosphorylation | 32103174 |
Tgene | PRKDC | GO:0034462 | small-subunit processome assembly | 32103174 |
Tgene | PRKDC | GO:0160049 | negative regulation of cGAS/STING signaling pathway | 33273464 |
Tgene | PRKDC | GO:2001034 | positive regulation of double-strand break repair via nonhomologous end joining | 26237645 |
Kinase Fusion gene breakpoints across CPQ (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across PRKDC (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
CCLE | JHUEM-3 | CPQ | chr8 | 97797558 | PRKDC | chr8 | 48696370 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000220763 | ENST00000338368 | CPQ | chr8 | 97797558 | PRKDC | chr8 | 48696370 | 2895 | 543 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000220763_ENST00000338368_CPQ_chr8_97797558_PRKDC_chr8_48696370_length(amino acids)=543 MEKKMKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEK AIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPEGQYDGRGKPLPEYHVRIAGFDERVTVMASLRR PKRIIIRGHDEREHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSACSQRALQLRTYSVVPMTSSDPRAPPCEYKDWLTKMSGKHDVGAY MLMYKGANRTETVTSFRKRESKVPADLLKRAFVRMSTSPEAFLALRSHFASSHALICISHWILGIGDRHLNNFMVAMETGGVIGIDFGHA FGSATQFLPVPELMPFRLTRQFINLMLPMKETGLMYSIMVHALRAFRSDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAE KNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWE -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr8:/chr8:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
CPQ | PRKDC |
FUNCTION: Carboxypeptidase that may play an important role in the hydrolysis of circulating peptides. Catalyzes the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in the liberation of thyroxine hormone from its thyroglobulin (Tg) precursor. | FUNCTION: Serine/threonine-protein kinase that acts as a molecular sensor for DNA damage (PubMed:11955432, PubMed:12649176, PubMed:14734805, PubMed:33854234). Involved in DNA non-homologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination (PubMed:11955432, PubMed:12649176, PubMed:14734805, PubMed:33854234, PubMed:34352203). Must be bound to DNA to express its catalytic properties (PubMed:11955432). Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C) (PubMed:11955432). Recruited by XRCC5 and XRCC6 to DNA ends and is required to (1) protect and align broken ends of DNA, thereby preventing their degradation, (2) and sequester the DSB for repair by NHEJ (PubMed:15574326, PubMed:11955432, PubMed:12649176, PubMed:14734805, PubMed:33854234). Act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage (PubMed:15574326, PubMed:11955432, PubMed:12649176, PubMed:14734805). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step (PubMed:15574326, PubMed:11955432, PubMed:12649176, PubMed:14734805). Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion (By similarity). Also involved in modulation of transcription (PubMed:15574326, PubMed:11955432, PubMed:12649176, PubMed:14734805). As part of the DNA-PK complex, involved in the early steps of ribosome assembly by promoting the processing of precursor rRNA into mature 18S rRNA in the small-subunit processome (PubMed:32103174). Binding to U3 small nucleolar RNA, recruits PRKDC and XRCC5/Ku86 to the small-subunit processome (PubMed:32103174). Recognizes the substrate consensus sequence [ST]-Q (PubMed:15574326, PubMed:11955432, PubMed:12649176, PubMed:14734805). Phosphorylates 'Ser-139' of histone variant H2AX, thereby regulating DNA damage response mechanism (PubMed:14627815, PubMed:16046194). Phosphorylates ASF1A, DCLRE1C, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, FH, SRF, NHEJ1/XLF, XRCC1, XRCC4, XRCC5, XRCC6, WRN, MYC and RFA2 (PubMed:2507541, PubMed:2247066, PubMed:1597196, PubMed:8407951, PubMed:8464713, PubMed:9362500, PubMed:9139719, PubMed:10026262, PubMed:10467406, PubMed:12509254, PubMed:11889123, PubMed:14612514, PubMed:14599745, PubMed:15177042, PubMed:18644470, PubMed:26666690, PubMed:30247612, PubMed:14704337, PubMed:16397295, PubMed:26237645, PubMed:28712728, PubMed:29478807). Can phosphorylate C1D not only in the presence of linear DNA but also in the presence of supercoiled DNA (PubMed:9679063). Ability to phosphorylate p53/TP53 in the presence of supercoiled DNA is dependent on C1D (PubMed:9363941). Contributes to the determination of the circadian period length by antagonizing phosphorylation of CRY1 'Ser-588' and increasing CRY1 protein stability, most likely through an indirect mechanism (By similarity). Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway (PubMed:28712728). Also regulates the cGAS-STING pathway by catalyzing phosphorylation of CGAS, thereby impairing CGAS oligomerization and activation (PubMed:33273464). Also regulates the cGAS-STING pathway by mediating phosphorylation of PARP1 (PubMed:35460603). {ECO:0000250|UniProtKB:P97313, ECO:0000269|PubMed:10026262, ECO:0000269|PubMed:10467406, ECO:0000269|PubMed:11889123, ECO:0000269|PubMed:11955432, ECO:0000269|PubMed:12509254, ECO:0000269|PubMed:12649176, ECO:0000269|PubMed:14599745, ECO:0000269|PubMed:14612514, ECO:0000269|PubMed:14627815, ECO:0000269|PubMed:14704337, ECO:0000269|PubMed:14734805, ECO:0000269|PubMed:15177042, ECO:0000269|PubMed:15574326, ECO:0000269|PubMed:1597196, ECO:0000269|PubMed:16046194, ECO:0000269|PubMed:16397295, ECO:0000269|PubMed:18644470, ECO:0000269|PubMed:2247066, ECO:0000269|PubMed:2507541, ECO:0000269|PubMed:26237645, ECO:0000269|PubMed:26666690, ECO:0000269|PubMed:28712728, ECO:0000269|PubMed:29478807, ECO:0000269|PubMed:30247612, ECO:0000269|PubMed:32103174, ECO:0000269|PubMed:33273464, ECO:0000269|PubMed:33854234, ECO:0000269|PubMed:34352203, ECO:0000269|PubMed:35460603, ECO:0000269|PubMed:8407951, ECO:0000269|PubMed:8464713, ECO:0000269|PubMed:9139719, ECO:0000269|PubMed:9362500, ECO:0000269|PubMed:9363941, ECO:0000269|PubMed:9679063}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | CPQ | 97797558 | PRKDC | 48696370 | ENST00000220763 | 77 | 87 | 4096_4128 | 3701 | 4128 | Domain | Note=FATC;Ontology_term=ECO:0000255,ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00534,ECO:0000255|PROSITE-ProRule:PRU00535 |
Tgene | CPQ | 97797558 | PRKDC | 48696370 | ENST00000220763 | 77 | 87 | 3722_4053 | 3701 | 4128 | Domain | Note=PI3K/PI4K catalytic;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00269 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>123_CPQ_PRKDC | ENST00000220763 | ENST00000338368 | CPQ | chr8 | 97797558 | PRKDC | chr8 | 48696370 | MEKKMKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEK AIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPEGQYDGRGKPLPEYHVRIAGFDERVTVMASLRR PKRIIIRGHDEREHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSACSQRALQLRTYSVVPMTSSDPRAPPCEYKDWLTKMSGKHDVGAY MLMYKGANRTETVTSFRKRESKVPADLLKRAFVRMSTSPEAFLALRSHFASSHALICISHWILGIGDRHLNNFMVAMETGGVIGIDFGHA FGSATQFLPVPELMPFRLTRQFINLMLPMKETGLMYSIMVHALRAFRSDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAE KNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWE | 543 |
3D view using mol* of 123_CPQ_PRKDC | ||||||||||
PDB file >>>TKFP_204_CPQ_PRKDC | ENST00000220763 | ENST00000338368 | CPQ | chr8 | 97797558 | PRKDC | chr8 | 48696370 | MEKKMKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEK AIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPEGQYDGRGKPLPEYHVRIAGFDERVTVMASLRR PKRIIIRGHDEREHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSACSQRALQLRTYSVVPMTSSDPRAPPCEYKDWLTKMSGKHDVGAY MLMYKGANRTETVTSFRKRESKVPADLLKRAFVRMSTSPEAFLALRSHFASSHALICISHWILGIGDRHLNNFMVAMETGGVIGIDFGHA FGSATQFLPVPELMPFRLTRQFINLMLPMKETGLMYSIMVHALRAFRSDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAE KNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWE | 543_CPQ_PRKDC |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
123_CPQ_PRKDC.png |
123_CPQ_PRKDC.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
123_CPQ_PRKDC_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Nilotinib | -8.408439999999999 | -8.54804 | -55.8943 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Nilotinib | -8.408439999999999 | -8.54804 | -55.8943 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Afatinib | -7.818960000000001 | -8.00126 | -52.4056 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Afatinib | -7.818960000000001 | -8.00126 | -52.4056 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Afatinib | -7.81756 | -8.00126 | -52.4056 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Afatinib | -7.77994 | -7.9622399999999995 | -53.1594 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Afatinib | -7.77994 | -7.9622399999999995 | -53.1594 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Afatinib | -7.77854 | -7.9622399999999995 | -53.1594 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Pazopanib | -7.6958899999999995 | -7.702789999999999 | -45.0962 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Pazopanib | -7.6958899999999995 | -7.702789999999999 | -45.0962 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Cobimetinib | -7.4133 | -7.4161 | -47.8839 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Capmatinib | -7.37125 | -7.37685 | -49.6368 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Binimetinib | -7.36817 | -7.376869999999999 | -44.0449 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Binimetinib | -7.36817 | -7.376869999999999 | -44.0449 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Larotrectinib | -7.357660000000001 | -7.357660000000001 | -52.6519 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Neratinib | -7.315360000000001 | -7.50126 | -51.6856 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Neratinib | -7.285589999999999 | -7.46789 | -50.9363 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Neratinib | -7.285589999999999 | -7.46789 | -50.9363 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Regorafenib | -7.12109 | -7.12109 | -48.6126 |
123_CPQ_PRKDC-DOCK_HTVS_1-001 | Infigratinib | -7.072369999999999 | -7.63917 | -52.1337 |
Top |
Kinase-Substrate Information of CPQ_PRKDC |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
PRKDC | P78527 | human | POU2F1 | P14859 | S92 | sQPsQQPsVQAAIPQ | |
PRKDC | P78527 | human | FUS | P35637 | T19 | QSYGAYPtQPGQGYs | |
PRKDC | P78527 | human | DCLRE1C | Q96SD1 | S503 | NDEITDEsLENFPSS | |
PRKDC | P78527 | human | MCC | P23508 | S120 | LRsELsQsQHEVNED | |
PRKDC | P78527 | human | POU5F1 | Q01860 | S93 | PQGGLEtsQPEGEAG | |
PRKDC | P78527 | human | IRF3 | Q14653 | T135 | GGGSTSDtQEDILDE | |
PRKDC | P78527 | human | POU2F1 | P14859 | T226 | LQAQNLLtQLPQQsQ | |
PRKDC | P78527 | human | XRCC4 | Q13426 | S327 | sLEtLRNssPEDLFD | XRCC4 |
PRKDC | P78527 | human | WRN | Q14191 | S319 | SNNLNLLsFEDSTTG | |
PRKDC | P78527 | human | XRCC4 | Q13426 | S304 | ENsRPDSsLPETSKK | XRCC4 |
PRKDC | P78527 | human | TP53 | P04637 | S37 | NVLsPLPsQAMDDLM | TAD2 |
PRKDC | P78527 | human | POLL | Q9UGP5 | T204 | EASDGEEtQVSAADL | |
PRKDC | P78527 | human | XPA | P23025 | S196 | RSLEVWGsQEALEEA | |
PRKDC | P78527 | human | FUS | P35637 | S42 | QQSYSGYsQSTDTSG | |
PRKDC | P78527 | human | POU2F1 | P14859 | S78 | QSKSNEEsGDsQQPs | |
PRKDC | P78527 | human | IGFBP3 | P17936 | S183 | KKGHAKDsQRYKVDy | |
PRKDC | P78527 | human | WRN | Q14191 | S440 | DTsYVIEsDEDLEME | |
PRKDC | P78527 | human | HSP90AA1 | P07900 | T7 | _MPEEtQtQDQPMEE | |
PRKDC | P78527 | human | XRCC5 | P13010 | S580 | GAHFsVSsLAEGsVT | |
PRKDC | P78527 | human | H2AX | P16104 | T136 | PsGGkkAtQAsQEy_ | |
PRKDC | P78527 | human | POU2F1 | P14859 | T100 | VQAAIPQtQLMLAGG | |
PRKDC | P78527 | human | HNRNPU | Q00839 | S59 | AMEPGNGsLDLGGDs | |
PRKDC | P78527 | human | RPA2 | P15927 | S29 | QsPGGFGsPAPsQAE | |
PRKDC | P78527 | human | TP53 | P04637 | S9 | EEPQsDPsVEPPLsQ | P53_TAD |
PRKDC | P78527 | human | FH | P07954 | T236 | IkIGRTHtQDAVPLT | Lyase_1 |
PRKDC | P78527 | human | PNKP | Q96T60 | S114 | EEtRtPEsQPDtPPG | |
PRKDC | P78527 | human | POU2F1 | P14859 | T162 | ASAATPMtQIPLsQP | |
PRKDC | P78527 | human | TP53 | P04637 | S46 | AMDDLMLsPDDIEQW | TAD2 |
PRKDC | P78527 | human | HOXA11 | P31270 | T119 | ANVYHHPtPAVSSNF | DUF3528 |
PRKDC | P78527 | human | SRF | P11831 | S446 | STMQVSHsQVQEPGG | |
PRKDC | P78527 | human | TP53 | P04637 | T18 | EPPLsQEtFsDLWkL | P53_TAD |
PRKDC | P78527 | human | AKT1 | P31749 | S473 | RPHFPQFsysAsGtA | Pkinase_C |
PRKDC | P78527 | human | XRCC6 | P12956 | S6 | __MsGWEsyykTEGD | |
PRKDC | P78527 | human | SOX2 | P48431 | S251 | VksEAsssPPVVtSS | |
PRKDC | P78527 | human | FUS | P35637 | S131 | QPQSGSYsQQPSYGG | |
PRKDC | P78527 | human | MAPKAP1 | Q9BPZ7 | S186 | VYLPLHssQDRLLPM | CRIM |
PRKDC | P78527 | human | FUS | P35637 | S30 | QGYsQQSsQPYGQQS | |
PRKDC | P78527 | human | DCLRE1C | Q96SD1 | S553 | QGsQGWDsQSDTVLL | |
PRKDC | P78527 | human | GOLPH3 | Q9H4A6 | T148 | KEtQPPEtVQNWIEL | GPP34 |
PRKDC | P78527 | human | WRN | Q14191 | S467 | DTsYVIEsDEDLEME | |
PRKDC | P78527 | human | FUS | P35637 | T68 | sQNTGYGtQSTPQGY | |
PRKDC | P78527 | human | NHEJ1 | Q9H9Q4 | S55 | QVDTSVVsQRAKELN | XLF |
PRKDC | P78527 | human | POU2F1 | P14859 | S167 | PMtQIPLsQPIQIAQ | |
PRKDC | P78527 | human | SRF | P11831 | S435 | LTVLNAFsQAPSTMQ | |
PRKDC | P78527 | human | DCLRE1C | Q96SD1 | S645 | NLSTNADsQsssDFE | |
PRKDC | P78527 | human | RPA2 | P15927 | S4 | ____MWNsGFEsyGs | |
PRKDC | P78527 | human | EGR1 | P18146 | S301 | AFATQSGsQDLKALN | |
PRKDC | P78527 | human | IKBKG | Q9Y6K9 | S43 | PAMLHLPsEQGAPEt | |
PRKDC | P78527 | human | POU2F1 | P14859 | S85 | sGDsQQPsQPsQQPs | |
PRKDC | P78527 | human | NABP2 | Q9BQ15 | S134 | NDSNPSAsQPTTGPS | |
PRKDC | P78527 | human | HNRNPU | Q00839-2 | S59 | AMEPGNGsLDLGGDS | |
PRKDC | P78527 | human | LIG4 | P49917 | T650 | HLkAPNLtNVNKISN | |
PRKDC | P78527 | human | VIM | P08670 | S459 | GQVINEtsQHHDDLE | |
PRKDC | P78527 | human | PRKDC | P78527 | T3950 | GHAFGSAtQFLPVPE | PI3_PI4_kinase |
PRKDC | P78527 | human | MAPKAP1 | Q9BPZ7 | S367 | DGVFEEDsQIDIATV | |
PRKDC | P78527 | human | XRCC5 | P13010 | S577 | EQGGAHFsVSsLAEG | |
PRKDC | P78527 | human | POU2F1 | P14859 | S81 | SNEEsGDsQQPsQPs | |
PRKDC | P78527 | human | XRCC1 | P18887 | S371 | FANtPKysQVLGLGG | BRCT |
PRKDC | P78527 | human | PELP1 | Q8IZL8 | S1033 | LAPEALPsQGEVERE | |
PRKDC | P78527 | human | VIM | P08670 | S430 | LREtNLDsLPLVDtH | |
PRKDC | P78527 | human | POU2F1 | P14859 | S232 | LtQLPQQsQANLLQS | |
PRKDC | P78527 | human | FUS | P35637 | T11 | NDYtQQAtQSYGAYP | |
PRKDC | P78527 | human | XRCC4 | Q13426 | S320 | HISAENMsLEtLRNs | XRCC4 |
PRKDC | P78527 | human | RAG2 | P55895 | S365 | EQTTFTNsQTSTEDP | RAG2 |
PRKDC | P78527 | human | XRCC6 | P12956 | S51 | AsKAMFEsQsEDELT | Ku_N |
PRKDC | P78527 | human | XRCC5 | P13010 | T715 | KDkPsGDtAAVFEEG | |
PRKDC | P78527 | human | PDX1 | P52945 | T11 | EEQYYAAtQLYKDPC | |
PRKDC | P78527 | human | PRKDC | P78527 | T2638 | VAGQIRAtQQQHDFt | DNAPKcs_CC5 |
PRKDC | P78527 | human | TOP1 | P11387 | S10 | GDHLHNDsQIEADFR | |
PRKDC | P78527 | human | PRKDC | P78527 | T2609 | LtPMFVEtQAsQGtL | DNAPKcs_CC5 |
PRKDC | P78527 | human | POU2F1 | P14859 | S147 | HsAsQQHsAAGATIS | |
PRKDC | P78527 | human | FUS | P35637 | S54 | TSGYGQSsYSSYGQs | |
PRKDC | P78527 | human | XRCC6 | P12956 | S27 | QEENLEAsGDykYsG | |
PRKDC | P78527 | human | MAPKAP1 | Q9BPZ7 | S343 | DLDSTLEsQSAWEFC | |
PRKDC | P78527 | human | PNKP | Q96T60 | S126 | PPGtPLVsQDEKRDA | |
PRKDC | P78527 | human | FUS | P35637 | S142 | SYGGQQQsYGQQQSY | |
PRKDC | P78527 | human | DCLRE1C | Q96SD1 | S516 | SSTVAGGsQsPKLFS | |
PRKDC | P78527 | human | NHEJ1 | Q9H9Q4 | T266 | QLVssAPtLsAPEKE | |
PRKDC | P78527 | human | H1-2 | P16403 | T146 | KkAAGGAtPkKSAKK | |
PRKDC | P78527 | human | PPARGC1A | Q9UBK2 | S636 | SRRPRyDsYEEYQHE | |
PRKDC | P78527 | human | CDKN1B | P46527 | S140 | PkTDPSDsQTGLAEQ | |
PRKDC | P78527 | human | XPA | P23025 | S173 | VKkNPHHsQWGDMKL | XPA_C |
PRKDC | P78527 | human | POU5F1 | Q01860 | S111 | EsNsDGAsPEPCtVt | |
PRKDC | P78527 | human | NFKB1 | P19838 | S20 | QMFHLDPsLTHTIFN | |
PRKDC | P78527 | human | PRKDC | P78527 | T2647 | QQHDFtLtQTADGRs | DNAPKcs_CC5 |
PRKDC | P78527 | human | DCLRE1C | Q96SD1 | S548 | THITEQGsQGWDsQS | |
PRKDC | P78527 | human | MCC | P23508 | S118 | SELRsELsQsQHEVN | |
PRKDC | P78527 | human | PRKDC | P78527 | S2612 | MFVEtQAsQGtLQtR | DNAPKcs_CC5 |
PRKDC | P78527 | human | YBX1 | P67809 | T89 | EDVFVHQtAIkkNNP | CSD |
PRKDC | P78527 | human | POLR2A | P24928 | S1616 | TPQSPSysPtsPsYS | RNA_pol_Rpb1_R |
PRKDC | P78527 | human | MED1 | Q15648 | T1457 | HsKsPAytPQNLDsE | |
PRKDC | P78527 | human | RPA2 | P15927 | S8 | MWNsGFEsyGsssyG | |
PRKDC | P78527 | human | ASF1A | Q9Y294 | S192 | GWSTSENsLNVMLES | |
PRKDC | P78527 | human | HSP90AA1 | P07900 | T5 | ___MPEEtQtQDQPM | |
PRKDC | P78527 | human | FUS | P35637 | S84 | STGGYGSsQSsQSSY | |
PRKDC | P78527 | human | AIRE | O43918 | T68 | ALLSWLLtQDSTAIL | HSR |
PRKDC | P78527 | human | HOXA11 | P31270 | S98 | RDCLQAPsAAGVPGD | DUF3528 |
PRKDC | P78527 | human | RPA2 | P15927 | S33 | GFGsPAPsQAEkkSR | |
PRKDC | P78527 | human | TP53 | P04637 | S20 | PLsQEtFsDLWkLLP | P53_TAD |
PRKDC | P78527 | human | FUS | P35637 | S117 | SGsYGSSsQSSSYGQ | |
PRKDC | P78527 | human | AIRE | O43918 | S156 | RGTASPGsQLKAKPP | |
PRKDC | P78527 | human | PRKAG1 | P54619 | T284 | LKCYLHEtLETIINR | CBS |
PRKDC | P78527 | human | RPA2 | P15927 | S23 | GAGGYtQsPGGFGsP | |
PRKDC | P78527 | human | NHEJ1 | Q9H9Q4 | S263 | QPEQLVssAPtLsAP | |
PRKDC | P78527 | human | FUS | P35637 | S61 | sYSSYGQsQNTGYGt | |
PRKDC | P78527 | human | FUS | P35637 | S26 | tQPGQGYsQQSsQPY | |
PRKDC | P78527 | human | GOLPH3 | Q9H4A6 | T143 | ALkHVKEtQPPEtVQ | GPP34 |
PRKDC | P78527 | human | DCLRE1C | Q96SD1 | S538 | HISsQNSsQSTHITE | |
PRKDC | P78527 | human | XRCC4 | Q13426 | S260 | KDDsIIssLDVtDIA | XRCC4 |
PRKDC | P78527 | human | POU2F1 | P14859 | S141 | AAAVQQHsAsQQHsA | |
PRKDC | P78527 | human | XRCC4 | Q13426 | S328 | LEtLRNssPEDLFDE | XRCC4 |
PRKDC | P78527 | human | PRKDC | P78527 | S3205 | tPLPEDNsMNVDQDG | FAT |
PRKDC | P78527 | human | POLR2A | P24928 | S1621 | SysPtsPsYSPTSPS | RNA_pol_Rpb1_R |
PRKDC | P78527 | human | TRIM28 | Q13263 | S824 | LPGAGLssQELsGGP | |
PRKDC | P78527 | human | CHEK2 | O96017 | T68 | SsLEtVstQELYsIP | |
PRKDC | P78527 | human | XRCC6 | P12956 | S33 | AsGDykYsGRDsLIF | |
PRKDC | P78527 | human | CASP2 | P42575 | S139 | LSCDYDLsLPFPVCE | |
PRKDC | P78527 | human | RPA2 | P15927 | T21 | yGGAGGYtQsPGGFG | |
PRKDC | P78527 | human | H2AX | P16104 | S139 | GkkAtQAsQEy____ | |
PRKDC | P78527 | human | TGM2 | P21980 | T162 | ERQEyVLtQQGFIYQ | |
PRKDC | P78527 | human | PRKAG1 | P54619 | S192 | KPEFMSKsLEELQIG | CBS |
PRKDC | P78527 | human | FUS | P35637 | S87 | GYGSsQSsQSSYGQQ | |
PRKDC | P78527 | human | NHEJ1 | Q9H9Q4 | S251 | AsLQGIDsQCVNQPE | |
PRKDC | P78527 | human | CHEK2 | O96017 | T387 | LMRtLCGtPtyLAPE | Pkinase |
PRKDC | P78527 | human | POU2F1 | P14859 | S88 | sQQPsQPsQQPsVQA | |
PRKDC | P78527 | human | TP53 | P04637 | S15 | PsVEPPLsQEtFsDL | P53_TAD |
PRKDC | P78527 | human | NHEJ1 | Q9H9Q4 | S245 | PHTSNSAsLQGIDsQ | |
PRKDC | P78527 | human | POU2F1 | P14859 | S143 | AVQQHsAsQQHsAAG | |
PRKDC | P78527 | human | TDP1 | Q9NUW8 | S81 | PKRQKsGsQEDLGWC | |
PRKDC | P78527 | human | USF1 | P22415 | S262 | RQSNHRLsEELQGLD | |
PRKDC | P78527 | human | PARP1 | P09874 | T594 | RSWGRVGtVIGSNkL | WGR |
PRKDC | P78527 | human | NHEJ1 | Q9H9Q4 | T223 | DLYMAVTtQEVQVGQ | |
PRKDC | P78527 | human | PRKDC | P78527 | S2056 | VQsYsYSsQDPRPAT | DNAPKcs_CC3 |
PRKDC | P78527 | human | NHEJ1 | Q9H9Q4 | S132 | LASPSLVsQHLIRPL | XLF |
PRKDC | P78527 | human | VCP | P55072 | S784 | NQGGAGPsQGsGGGt | |
PRKDC | P78527 | human | DCLRE1C | Q96SD1 | S534 | GESTHISsQNSsQST | |
PRKDC | P78527 | human | PNPT1 | Q8TCS8 | S776 | IVMGEPIsQSSSNsQ | |
PRKDC | P78527 | human | VIM | P08670 | S56 | srsLyAssPGGVyAt | Filament_head |
PRKDC | P78527 | human | CHEK2 | O96017 | T383 | GEtsLMRtLCGtPty | Pkinase |
PRKDC | P78527 | human | AKT1 | P31749 | T308 | kDGAtMKtFCGtPEy | Pkinase |
PRKDC | P78527 | human | FUS | P35637 | T7 | _MASNDYtQQAtQSY | |
PRKDC | P78527 | human | FUS | P35637 | S112 | APSSTSGsYGSSsQS |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
PRKDC | ID | Description | 0.00e+00 |
PRKDC | GO:0006302 | double-strand break repair | 1.34e-18 |
PRKDC | GO:0010212 | response to ionizing radiation | 3.95e-15 |
PRKDC | GO:0006310 | DNA recombination | 7.61e-14 |
PRKDC | GO:0009314 | response to radiation | 1.28e-13 |
PRKDC | GO:0010332 | response to gamma radiation | 1.34e-13 |
PRKDC | GO:0006303 | double-strand break repair via nonhomologous end joining | 1.52e-12 |
PRKDC | GO:0000723 | telomere maintenance | 1.03e-11 |
PRKDC | GO:0032200 | telomere organization | 7.93e-11 |
PRKDC | GO:0071480 | cellular response to gamma radiation | 3.10e-10 |
PRKDC | GO:0051054 | positive regulation of DNA metabolic process | 8.10e-10 |
PRKDC | GO:0006266 | DNA ligation | 8.67e-10 |
PRKDC | GO:0033151 | V(D)J recombination | 1.23e-09 |
PRKDC | GO:0071479 | cellular response to ionizing radiation | 5.50e-09 |
PRKDC | GO:0006284 | base-excision repair | 8.28e-09 |
PRKDC | GO:0000725 | recombinational repair | 1.89e-08 |
PRKDC | GO:0071478 | cellular response to radiation | 1.98e-08 |
PRKDC | GO:0031571 | mitotic G1 DNA damage checkpoint signaling | 2.83e-08 |
PRKDC | GO:0044819 | mitotic G1/S transition checkpoint signaling | 2.83e-08 |
PRKDC | GO:0071214 | cellular response to abiotic stimulus | 2.83e-08 |
PRKDC | GO:0104004 | cellular response to environmental stimulus | 2.83e-08 |
PRKDC | GO:0002520 | immune system development | 3.82e-08 |
PRKDC | GO:0002200 | somatic diversification of immune receptors | 3.36e-07 |
PRKDC | GO:0071897 | DNA biosynthetic process | 5.73e-07 |
PRKDC | GO:2000628 | regulation of miRNA metabolic process | 6.14e-07 |
PRKDC | GO:1902807 | negative regulation of cell cycle G1/S phase transition | 1.19e-06 |
PRKDC | GO:0010165 | response to X-ray | 1.91e-06 |
PRKDC | GO:0010586 | miRNA metabolic process | 2.21e-06 |
PRKDC | GO:0000012 | single strand break repair | 2.73e-06 |
PRKDC | GO:2000630 | positive regulation of miRNA metabolic process | 2.75e-06 |
PRKDC | GO:0090398 | cellular senescence | 2.75e-06 |
PRKDC | GO:0000724 | double-strand break repair via homologous recombination | 3.55e-06 |
PRKDC | GO:0048732 | gland development | 4.67e-06 |
PRKDC | GO:0060218 | hematopoietic stem cell differentiation | 4.67e-06 |
PRKDC | GO:0002562 | somatic diversification of immune receptors via germline recombination within a single locus | 4.67e-06 |
PRKDC | GO:0016444 | somatic cell DNA recombination | 4.67e-06 |
PRKDC | GO:0000077 | DNA damage checkpoint signaling | 5.86e-06 |
PRKDC | GO:0000075 | cell cycle checkpoint signaling | 6.09e-06 |
PRKDC | GO:0045739 | positive regulation of DNA repair | 6.89e-06 |
PRKDC | GO:1901988 | negative regulation of cell cycle phase transition | 7.29e-06 |
PRKDC | GO:0006260 | DNA replication | 7.33e-06 |
PRKDC | GO:0031570 | DNA integrity checkpoint signaling | 8.27e-06 |
PRKDC | GO:1903131 | mononuclear cell differentiation | 8.45e-06 |
PRKDC | GO:0044773 | mitotic DNA damage checkpoint signaling | 8.95e-06 |
PRKDC | GO:1902806 | regulation of cell cycle G1/S phase transition | 9.77e-06 |
PRKDC | GO:0006289 | nucleotide-excision repair | 9.77e-06 |
PRKDC | GO:0006977 | DNA damage respons | 2.22e-07 |
PRKDC | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle | 9.77e-06 |
PRKDC | GO:0007093 | mitotic cell cycle checkpoint signaling | 9.77e-06 |
PRKDC | GO:0033077 | T cell differentiation in thymus | 1.00e-05 |
Top |
Related Drugs to CPQ_PRKDC |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning CPQ-PRKDC and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to CPQ_PRKDC |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |