UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:CPSF6_CDK13 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: CPSF6_CDK13 | KinaseFusionDB ID: KFG1426 | FusionGDB2.0 ID: KFG1426 | Hgene | Tgene | Gene symbol | CPSF6 | CDK13 | Gene ID | 11052 | 8621 | |
Gene name | cleavage and polyadenylation specific factor 6 | cyclin dependent kinase 13 | ||||||||||
Synonyms | CFIM|CFIM68|CFIM72|HPBRII-4|HPBRII-7 | CDC2L|CDC2L5|CHDFIDD|CHED|hCDK13 | ||||||||||
Cytomap | 12q15 | 7p14.1 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | cleavage and polyadenylation specificity factor subunit 6CPSF 68 kDa subunitcleavage and polyadenylation specific factor 6, 68kDacleavage and polyadenylation specificity factor 68 kDa subunitcleavage factor Im complex 68 kDa subunitpre-mRNA cleavage | cyclin-dependent kinase 13CDC2-related protein kinase 5cell division cycle 2-like protein kinase 5cell division protein kinase 13cholinesterase-related cell division controller | ||||||||||
Modification date | 20240411 | 20240407 | ||||||||||
UniProtAcc | Q16630 | Q14004 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000266679, ENST00000435070, ENST00000456847, ENST00000551516, ENST00000550987, | ENST00000181839, ENST00000340829, ENST00000484589, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: CPSF6 [Title/Abstract] AND CDK13 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CPSF6(69656342)-CDK13(40027198), # samples:1 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CPSF6 | GO:0006397 | mRNA processing | 14690600 |
Hgene | CPSF6 | GO:0031124 | mRNA 3'-end processing | 20695905 |
Hgene | CPSF6 | GO:0051179 | localization | 30916345 |
Hgene | CPSF6 | GO:0051262 | protein tetramerization | 20695905 |
Hgene | CPSF6 | GO:0051290 | protein heterotetramerization | 23187700 |
Tgene | CDK13 | GO:0009966 | regulation of signal transduction | 26748711 |
Tgene | CDK13 | GO:0032968 | positive regulation of transcription elongation by RNA polymerase II | 26748711 |
Tgene | CDK13 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 20952539 |
Kinase Fusion gene breakpoints across CPSF6 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across CDK13 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-D7-8574-01A | CPSF6 | chr12 | 69656342 | CDK13 | chr7 | 40027198 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000551516 | ENST00000181839 | CPSF6 | chr12 | 69656342 | CDK13 | chr7 | 40027198 | 5654 | 1164 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000551516_ENST00000181839_CPSF6_chr12_69656342_CDK13_chr7_40027198_length(amino acids)=1164 MADGVDHIDIYADVGEEFNQEAEYEREAENERGTGIVTETVTESVTESANIVIVRRRSGKSRSRSPYSSRHSRSRSRHRLSRSRSRHSSI SPSTLTLKSSLAAELNKNKKARAAEAARAAEAAKAAEATKAAEAAAKAAKASNTSTPTKGNTETSASASQTNHVKDVKKIKIEHAPSPSS GGTLKNDKAKTKPPLQVTKVENNLIVDKATKKAVIVGKESKSAATKEESVSLKEKTKPLTPSIGAKEKEQHVALVTSTLPPLPLPPMLPE DKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDKFDII GIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDL MGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGE ERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLFDYM LALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSKKRRRQKQMGMTDDVSTIKAPRKDLSLGLDDSRTNTPQGVLPSSQL KSQGSSNVAPVKTGPGQHLNHSELAILLNLLQSKTSVNMADFVQVLNIKVNSETQQQLNKINLPAGILATGEKQTDPSTPQQESSKPLGG IQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDVLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPE PDRPRILPPDQRPPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGGIDYQAGDTYVSTSDYKDN FGSSSFSSAPYVSNDGLGSSSAPPLERRSFIGNSDIQSLDNYSTASSHSGGPPQPSAFSESFPSSVAGYGDIYLNAGPMLFSGDKDHRFE -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr12:69656342/chr7:40027198) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
CPSF6 | CDK13 |
FUNCTION: Component of the cleavage factor Im (CFIm) complex that functions as an activator of the pre-mRNA 3'-end cleavage and polyadenylation processing required for the maturation of pre-mRNA into functional mRNAs (PubMed:9659921, PubMed:8626397, PubMed:14690600, PubMed:29276085). CFIm contributes to the recruitment of multiprotein complexes on specific sequences on the pre-mRNA 3'-end, so called cleavage and polyadenylation signals (pA signals) (PubMed:9659921, PubMed:8626397, PubMed:14690600). Most pre-mRNAs contain multiple pA signals, resulting in alternative cleavage and polyadenylation (APA) producing mRNAs with variable 3'-end formation (PubMed:23187700, PubMed:29276085). The CFIm complex acts as a key regulator of cleavage and polyadenylation site choice during APA through its binding to 5'-UGUA-3' elements localized in the 3'-untranslated region (UTR) for a huge number of pre-mRNAs (PubMed:20695905, PubMed:29276085). CPSF6 enhances NUDT21/CPSF5 binding to 5'-UGUA-3' elements localized upstream of pA signals and promotes RNA looping, and hence activates directly the mRNA 3'-processing machinery (PubMed:15169763, PubMed:29276085, PubMed:21295486). Plays a role in mRNA export (PubMed:19864460). {ECO:0000269|PubMed:14690600, ECO:0000269|PubMed:15169763, ECO:0000269|PubMed:19864460, ECO:0000269|PubMed:20695905, ECO:0000269|PubMed:21295486, ECO:0000269|PubMed:23187700, ECO:0000269|PubMed:29276085, ECO:0000269|PubMed:8626397, ECO:0000269|PubMed:9659921}.; FUNCTION: (Microbial infection) Binds HIV-1 capsid-nucleocapsid (HIV-1 CA-NC) complexes and might thereby promote the integration of the virus in the nucleus of dividing cells (in vitro). {ECO:0000269|PubMed:24130490}. | FUNCTION: Cyclin-dependent kinase which displays CTD kinase activity and is required for RNA splicing. Has CTD kinase activity by hyperphosphorylating the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit RPB1, thereby acting as a key regulator of transcription elongation. Required for RNA splicing, probably by phosphorylating SRSF1/SF2. Required during hematopoiesis. In case of infection by HIV-1 virus, interacts with HIV-1 Tat protein acetylated at 'Lys-50' and 'Lys-51', thereby increasing HIV-1 mRNA splicing and promoting the production of the doubly spliced HIV-1 protein Nef. {ECO:0000269|PubMed:16721827, ECO:0000269|PubMed:1731328, ECO:0000269|PubMed:18480452, ECO:0000269|PubMed:20952539}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | CPSF6 | 69656342 | CDK13 | 40027198 | ENST00000551516 | 0 | 14 | 705_998 | 403 | 1453 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | CPSF6 | 69656342 | CDK13 | 40027198 | ENST00000551516 | 0 | 14 | 705_998 | 403 | 1513 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>124_CPSF6_CDK13 | ENST00000551516 | ENST00000181839 | CPSF6 | chr12 | 69656342 | CDK13 | chr7 | 40027198 | MADGVDHIDIYADVGEEFNQEAEYEREAENERGTGIVTETVTESVTESANIVIVRRRSGKSRSRSPYSSRHSRSRSRHRLSRSRSRHSSI SPSTLTLKSSLAAELNKNKKARAAEAARAAEAAKAAEATKAAEAAAKAAKASNTSTPTKGNTETSASASQTNHVKDVKKIKIEHAPSPSS GGTLKNDKAKTKPPLQVTKVENNLIVDKATKKAVIVGKESKSAATKEESVSLKEKTKPLTPSIGAKEKEQHVALVTSTLPPLPLPPMLPE DKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDKFDII GIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDL MGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGE ERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLFDYM LALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSKKRRRQKQMGMTDDVSTIKAPRKDLSLGLDDSRTNTPQGVLPSSQL KSQGSSNVAPVKTGPGQHLNHSELAILLNLLQSKTSVNMADFVQVLNIKVNSETQQQLNKINLPAGILATGEKQTDPSTPQQESSKPLGG IQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDVLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPE PDRPRILPPDQRPPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGGIDYQAGDTYVSTSDYKDN FGSSSFSSAPYVSNDGLGSSSAPPLERRSFIGNSDIQSLDNYSTASSHSGGPPQPSAFSESFPSSVAGYGDIYLNAGPMLFSGDKDHRFE | 1164 |
3D view using mol* of 124_CPSF6_CDK13 | ||||||||||
PDB file >>>TKFP_205_CPSF6_CDK13 | ENST00000551516 | ENST00000181839 | CPSF6 | chr12 | 69656342 | CDK13 | chr7 | 40027198 | MADGVDHIDIYADVGEEFNQEAEYEREAENERGTGIVTETVTESVTESANIVIVRRRSGKSRSRSPYSSRHSRSRSRHRLSRSRSRHSSI SPSTLTLKSSLAAELNKNKKARAAEAARAAEAAKAAEATKAAEAAAKAAKASNTSTPTKGNTETSASASQTNHVKDVKKIKIEHAPSPSS GGTLKNDKAKTKPPLQVTKVENNLIVDKATKKAVIVGKESKSAATKEESVSLKEKTKPLTPSIGAKEKEQHVALVTSTLPPLPLPPMLPE DKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDKFDII GIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDL MGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGE ERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLFDYM LALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSKKRRRQKQMGMTDDVSTIKAPRKDLSLGLDDSRTNTPQGVLPSSQL KSQGSSNVAPVKTGPGQHLNHSELAILLNLLQSKTSVNMADFVQVLNIKVNSETQQQLNKINLPAGILATGEKQTDPSTPQQESSKPLGG IQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDVLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPE PDRPRILPPDQRPPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGGIDYQAGDTYVSTSDYKDN FGSSSFSSAPYVSNDGLGSSSAPPLERRSFIGNSDIQSLDNYSTASSHSGGPPQPSAFSESFPSSVAGYGDIYLNAGPMLFSGDKDHRFE | 1164_CPSF6_CDK13 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
124_CPSF6_CDK13.png |
124_CPSF6_CDK13.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
124_CPSF6_CDK13_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Netarsudil | -7.03377 | -7.0448699999999995 | -46.3618 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Netarsudil | -7.03377 | -7.0448699999999995 | -46.3618 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Pralsetinib | -6.22895 | -6.32045 | -46.7204 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Cobimetinib | -6.17689 | -6.17969 | -38.8708 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Gilteritinib | -6.175730000000001 | -6.20213 | -43.7845 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Gilteritinib | -6.175730000000001 | -6.20213 | -43.7845 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Pralsetinib | -6.1064300000000005 | -6.19793 | -48.0336 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Lapatinib | -6.07702 | -6.16582 | -50.9228 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Dabrafenib | -6.037999999999999 | -6.454 | -39.2633 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Dabrafenib | -6.037999999999999 | -6.454 | -39.2633 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Pralsetinib | -6.0287 | -6.1202 | -45.9383 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Ruxolitinib | -5.96842 | -5.96842 | -33.8232 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Zanubrutinib | -5.9589300000000005 | -5.9589300000000005 | -29.77 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Pralsetinib | -5.86386 | -5.95536 | -45.1021 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Axitinib | -5.84141 | -5.844609999999999 | -35.8481 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Futibatinib | -5.82965 | -5.82965 | -37.6853 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Cabozantinib | -5.82511 | -5.8701099999999995 | -40.289 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Cabozantinib | -5.82511 | -5.8701099999999995 | -40.289 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Nilotinib | -5.80971 | -6.73451 | -46.1064 |
124_CPSF6_CDK13-DOCK_HTVS_1-001 | Nilotinib | -5.80971 | -6.73451 | -46.1064 |
Top |
Kinase-Substrate Information of CPSF6_CDK13 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
CDK13 | Q14004 | human | SERINC5 | Q86VE9 | S360 | ARCCFCFsPGGEDTE | Serinc |
CDK13 | Q14004 | human | EIF4EBP1 | Q13541 | S65 | FLMECrNsPVtktPP | eIF_4EBP |
CDK13 | Q14004 | human | EIF4B | P23588 | S406 | RPRERHPsWRsEEtQ | |
CDK13 | Q14004 | human | POLR2A | P24928 | S1616 | TPQSPSysPtsPsYS | RNA_pol_Rpb1_R |
CDK13 | Q14004 | human | EIF4EBP1 | Q13541 | T70 | rNsPVtktPPRDLPt | eIF_4EBP |
CDK13 | Q14004 | human | POLR2A | P24928 | S1619 | SPSysPtsPsYSPTS | RNA_pol_Rpb1_R |
CDK13 | Q14004 | human | EIF4EBP1 | Q13541 | T46 | GGtLFsttPGGtRII | eIF_4EBP |
CDK13 | Q14004 | human | EIF4B | P23588 | S422 | RERsRtGsEssQtGt |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
CDK13 | ID | Description | 0.00e+00 |
CDK13 | GO:0006446 | regulation of translational initiation | 5.02e-03 |
CDK13 | GO:0006413 | translational initiation | 5.52e-03 |
CDK13 | GO:0032329 | serine transport | 3.03e-02 |
CDK13 | GO:0006563 | L-serine metabolic process | 3.03e-02 |
CDK13 | GO:0009070 | serine family amino acid biosynthetic process | 3.06e-02 |
CDK13 | GO:0045947 | negative regulation of translational initiation | 3.06e-02 |
CDK13 | GO:0006658 | phosphatidylserine metabolic process | 3.06e-02 |
CDK13 | GO:0006353 | DNA-templated transcription termination | 3.49e-02 |
CDK13 | GO:0009069 | serine family amino acid metabolic process | 4.13e-02 |
CDK13 | GO:0033120 | positive regulation of RNA splicing | 4.28e-02 |
CDK13 | GO:0015804 | neutral amino acid transport | 4.90e-02 |
CDK13 | GO:1901607 | alpha-amino acid biosynthetic process | 5.33e-02 |
CDK13 | GO:0008652 | amino acid biosynthetic process | 5.49e-02 |
CDK13 | GO:0015807 | L-amino acid transport | 5.95e-02 |
CDK13 | GO:0006575 | cellular modified amino acid metabolic process | 6.91e-02 |
CDK13 | GO:0045931 | positive regulation of mitotic cell cycle | 6.91e-02 |
CDK13 | GO:0042552 | myelination | 6.91e-02 |
CDK13 | GO:0007272 | ensheathment of neurons | 6.91e-02 |
CDK13 | GO:0008366 | axon ensheathment | 6.91e-02 |
CDK13 | GO:0006865 | amino acid transport | 6.91e-02 |
CDK13 | GO:0031929 | TOR signaling | 7.32e-02 |
CDK13 | GO:0043484 | regulation of RNA splicing | 7.56e-02 |
CDK13 | GO:1901605 | alpha-amino acid metabolic process | 8.26e-02 |
CDK13 | GO:0000082 | G1/S transition of mitotic cell cycle | 8.63e-02 |
CDK13 | GO:0008654 | phospholipid biosynthetic process | 8.63e-02 |
CDK13 | GO:0044843 | cell cycle G1/S phase transition | 8.63e-02 |
CDK13 | GO:0006520 | amino acid metabolic process | 8.63e-02 |
CDK13 | GO:0006650 | glycerophospholipid metabolic process | 8.63e-02 |
CDK13 | GO:0017148 | negative regulation of translation | 8.63e-02 |
CDK13 | GO:0045787 | positive regulation of cell cycle | 8.63e-02 |
CDK13 | GO:0046394 | carboxylic acid biosynthetic process | 8.63e-02 |
CDK13 | GO:0051607 | defense response to virus | 8.63e-02 |
CDK13 | GO:0140546 | defense response to symbiont | 8.63e-02 |
CDK13 | GO:0016053 | organic acid biosynthetic process | 8.63e-02 |
CDK13 | GO:0034249 | negative regulation of amide metabolic process | 8.63e-02 |
CDK13 | GO:0046942 | carboxylic acid transport | 8.63e-02 |
CDK13 | GO:0015849 | organic acid transport | 8.63e-02 |
CDK13 | GO:0006644 | phospholipid metabolic process | 8.93e-02 |
CDK13 | GO:0046486 | glycerolipid metabolic process | 9.04e-02 |
CDK13 | GO:0051347 | positive regulation of transferase activity | 9.34e-02 |
CDK13 | GO:0009615 | response to virus | 9.50e-02 |
CDK13 | GO:0015711 | organic anion transport | 9.50e-02 |
CDK13 | GO:0044772 | mitotic cell cycle phase transition | 9.75e-02 |
CDK13 | GO:0008380 | RNA splicing | 9.75e-02 |
Top |
Related Drugs to CPSF6_CDK13 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning CPSF6-CDK13 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to CPSF6_CDK13 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |