UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:CREB3L3_PKN3 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: CREB3L3_PKN3 | KinaseFusionDB ID: KFG1430 | FusionGDB2.0 ID: KFG1430 | Hgene | Tgene | Gene symbol | CREB3L3 | PKN3 | Gene ID | 84699 | 29941 | |
Gene name | cAMP responsive element binding protein 3 like 3 | protein kinase N3 | ||||||||||
Synonyms | CREB-H|CREBH|HYST1481|HYTG2 | UTDP4-1 | ||||||||||
Cytomap | 19p13.3 | 9q34.11 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | cyclic AMP-responsive element-binding protein 3-like protein 3CREB/ATF family transcription factorcAMP-responsive element-binding protein, hepatic-specific | serine/threonine-protein kinase N3protein kinase PKN-betaprotein-kinase C-related kinase 3 | ||||||||||
Modification date | 20240305 | 20240305 | ||||||||||
UniProtAcc | Q68CJ9 | Q6P5Z2 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000078445, ENST00000595923, ENST00000602147, ENST00000602257, ENST00000252587, | ENST00000485301, ENST00000291906, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: CREB3L3 [Title/Abstract] AND PKN3 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CREB3L3(4171172)-PKN3(131467582), # samples:3 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CREB3L3 | GO:0034976 | response to endoplasmic reticulum stress | 16469704 |
Hgene | CREB3L3 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 16469704 |
Tgene | PKN3 | GO:0010631 | epithelial cell migration | 21754995 |
Kinase Fusion gene breakpoints across CREB3L3 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across PKN3 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-G3-A7M7-01A | CREB3L3 | chr19 | 4171172 | PKN3 | chr9 | 131467582 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000078445 | ENST00000291906 | CREB3L3 | chr19 | 4171172 | PKN3 | chr9 | 131467582 | 4080 | 1230 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000078445_ENST00000291906_CREB3L3_chr19_4171172_PKN3_chr9_131467582_length(amino acids)=1230 MAVGGPPAWSRDPPRHLQTELDGPMNTDLAAGKMASAACSMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDSDDFLSS ILGSGDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGKGPCLSYHPGNSCSTTTPGPVIQVPEASVTIDLEMWS PGGRICAEKPADPVDLSPRCNLTVKDLLLSGSSGDLQQHHLGASYLLRPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYEERVLKK IRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQSTSKSAQTGTCVAPGPSQWPPEDE KEVIRRAIQKELKIKEGVENLRRVATDRRHLGHVQQLLRSSNRRLEQLHGELRELHARILLPGPGPGPAEPVASGPRPWAEQLRARHLEA LRRQLHVELKVKQGAENMTHTCASGTPKERKLLAAAQQMLRDSQLKVALLRMKISSLEASGSPEPGPELLAEELQHRLHVEAAVAEGAKN VVKLLSSRRTQDRKALAEAQAQLQESSQKLDLLRLALEQLLEQLPPAHPLRSRVTRELRAAVPGYPQPSGTPVKPTALTGTLQVRLLGCE QLLTAVPGRSPAAALASSPSEGWLRTKAKHQRGRGELASEVLAVLKVDNRVVGQTGWGQVAEQSWDQTFVIPLERARELEIGVHWRDWRQ LCGVAFLRLEDFLDNACHQLSLSLVPQGLLFAQVTFCDPVIERRPRLQRQERIFSKRRGQDFLRASQMNLGMAAWGRLVMNLLPPCSSPS TISPPKGCPRTPTTLREASDPATPSNFLPKKTPLGEEMTPPPKPPRLYLPQEPTSEETPRTKRPHMEPRTRRGPSPPASPTRKPPRLQDF RCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDEIESLYCEKRILEAVGCTGHPFLLSLLACFQTSSHACFVTEFVPGGDLMM QIHEDVFPEPQARFYVACVVLGLQFLHEKKIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFCGTPEFLAPEVLTQEAYTRA VDWWGLGVLLYEMLVGECPFPGDTEEEVFDCIVNMDAPYPGFLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLAR -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:4171172/chr9:131467582) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
CREB3L3 | PKN3 |
FUNCTION: Transcription factor that may act during endoplasmic reticulum stress by activating unfolded protein response target genes. Activated in response to cAMP stimulation. In vitro, binds to the cAMP response element (CRE) and box-B element. Activates transcription through box-B element. Activates transcription through CRE (By similarity). May function synergistically with ATF6. In acute inflammatory response, may activate expression of acute phase response (APR) genes. May be involved in growth suppression. Regulates FGF21 transcription (By similarity). Plays a crucial role in the regulation of triglyceride metabolism and is required for the maintenance of normal plasma triglyceride concentrations (PubMed:21666694). {ECO:0000250, ECO:0000250|UniProtKB:Q91XE9, ECO:0000269|PubMed:11353085, ECO:0000269|PubMed:15800215, ECO:0000269|PubMed:16469704, ECO:0000269|PubMed:21666694}. | FUNCTION: Contributes to invasiveness in malignant prostate cancer. {ECO:0000269|PubMed:15282551}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | CREB3L3 | 4171172 | PKN3 | 131467582 | ENST00000078445 | 0 | 22 | 819_889 | 8 | 890 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Tgene | CREB3L3 | 4171172 | PKN3 | 131467582 | ENST00000078445 | 0 | 22 | 559_818 | 8 | 890 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | CREB3L3 | 4171172 | PKN3 | 131467582 | ENST00000078445 | 0 | 22 | 5_80 | 8 | 890 | Domain | Note=REM-1 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | CREB3L3 | 4171172 | PKN3 | 131467582 | ENST00000078445 | 0 | 22 | 93_163 | 8 | 890 | Domain | Note=REM-1 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Tgene | CREB3L3 | 4171172 | PKN3 | 131467582 | ENST00000078445 | 0 | 22 | 165_245 | 8 | 890 | Domain | Note=REM-1 3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01207 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>126_CREB3L3_PKN3 | ENST00000078445 | ENST00000291906 | CREB3L3 | chr19 | 4171172 | PKN3 | chr9 | 131467582 | MAVGGPPAWSRDPPRHLQTELDGPMNTDLAAGKMASAACSMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDSDDFLSS ILGSGDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGKGPCLSYHPGNSCSTTTPGPVIQVPEASVTIDLEMWS PGGRICAEKPADPVDLSPRCNLTVKDLLLSGSSGDLQQHHLGASYLLRPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYEERVLKK IRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQSTSKSAQTGTCVAPGPSQWPPEDE KEVIRRAIQKELKIKEGVENLRRVATDRRHLGHVQQLLRSSNRRLEQLHGELRELHARILLPGPGPGPAEPVASGPRPWAEQLRARHLEA LRRQLHVELKVKQGAENMTHTCASGTPKERKLLAAAQQMLRDSQLKVALLRMKISSLEASGSPEPGPELLAEELQHRLHVEAAVAEGAKN VVKLLSSRRTQDRKALAEAQAQLQESSQKLDLLRLALEQLLEQLPPAHPLRSRVTRELRAAVPGYPQPSGTPVKPTALTGTLQVRLLGCE QLLTAVPGRSPAAALASSPSEGWLRTKAKHQRGRGELASEVLAVLKVDNRVVGQTGWGQVAEQSWDQTFVIPLERARELEIGVHWRDWRQ LCGVAFLRLEDFLDNACHQLSLSLVPQGLLFAQVTFCDPVIERRPRLQRQERIFSKRRGQDFLRASQMNLGMAAWGRLVMNLLPPCSSPS TISPPKGCPRTPTTLREASDPATPSNFLPKKTPLGEEMTPPPKPPRLYLPQEPTSEETPRTKRPHMEPRTRRGPSPPASPTRKPPRLQDF RCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDEIESLYCEKRILEAVGCTGHPFLLSLLACFQTSSHACFVTEFVPGGDLMM QIHEDVFPEPQARFYVACVVLGLQFLHEKKIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFCGTPEFLAPEVLTQEAYTRA VDWWGLGVLLYEMLVGECPFPGDTEEEVFDCIVNMDAPYPGFLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLAR | 1230 |
3D view using mol* of 126_CREB3L3_PKN3 | ||||||||||
PDB file >>>TKFP_207_CREB3L3_PKN3 | ENST00000078445 | ENST00000291906 | CREB3L3 | chr19 | 4171172 | PKN3 | chr9 | 131467582 | MAVGGPPAWSRDPPRHLQTELDGPMNTDLAAGKMASAACSMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDSDDFLSS ILGSGDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGKGPCLSYHPGNSCSTTTPGPVIQVPEASVTIDLEMWS PGGRICAEKPADPVDLSPRCNLTVKDLLLSGSSGDLQQHHLGASYLLRPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYEERVLKK IRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQSTSKSAQTGTCVAPGPSQWPPEDE KEVIRRAIQKELKIKEGVENLRRVATDRRHLGHVQQLLRSSNRRLEQLHGELRELHARILLPGPGPGPAEPVASGPRPWAEQLRARHLEA LRRQLHVELKVKQGAENMTHTCASGTPKERKLLAAAQQMLRDSQLKVALLRMKISSLEASGSPEPGPELLAEELQHRLHVEAAVAEGAKN VVKLLSSRRTQDRKALAEAQAQLQESSQKLDLLRLALEQLLEQLPPAHPLRSRVTRELRAAVPGYPQPSGTPVKPTALTGTLQVRLLGCE QLLTAVPGRSPAAALASSPSEGWLRTKAKHQRGRGELASEVLAVLKVDNRVVGQTGWGQVAEQSWDQTFVIPLERARELEIGVHWRDWRQ LCGVAFLRLEDFLDNACHQLSLSLVPQGLLFAQVTFCDPVIERRPRLQRQERIFSKRRGQDFLRASQMNLGMAAWGRLVMNLLPPCSSPS TISPPKGCPRTPTTLREASDPATPSNFLPKKTPLGEEMTPPPKPPRLYLPQEPTSEETPRTKRPHMEPRTRRGPSPPASPTRKPPRLQDF RCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDEIESLYCEKRILEAVGCTGHPFLLSLLACFQTSSHACFVTEFVPGGDLMM QIHEDVFPEPQARFYVACVVLGLQFLHEKKIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFCGTPEFLAPEVLTQEAYTRA VDWWGLGVLLYEMLVGECPFPGDTEEEVFDCIVNMDAPYPGFLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLAR | 1230_CREB3L3_PKN3 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
126_CREB3L3_PKN3.png |
126_CREB3L3_PKN3.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
126_CREB3L3_PKN3_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Lapatinib | -8.124839999999999 | -8.21364 | -67.4272 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Gilteritinib | -7.599760000000001 | -7.6261600000000005 | -50.1624 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Gilteritinib | -7.599760000000001 | -7.6261600000000005 | -50.1624 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Neratinib | -7.48567 | -7.67157 | -58.8837 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Neratinib | -7.261080000000001 | -7.44338 | -57.7467 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Neratinib | -7.261080000000001 | -7.44338 | -57.7467 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Neratinib | -7.129060000000001 | -7.314960000000001 | -54.6282 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Neratinib | -7.040660000000001 | -7.2229600000000005 | -54.0408 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Neratinib | -7.040660000000001 | -7.2229600000000005 | -54.0408 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Erdafitinib | -6.84002 | -6.8402199999999995 | -53.7194 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Lapatinib | -6.7595 | -6.8483 | -62.6231 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Lapatinib | -6.6714899999999995 | -7.83989 | -62.3201 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Lapatinib | -6.6714899999999995 | -7.83989 | -62.3201 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Cobimetinib | -6.389819999999999 | -6.39262 | -45.5278 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Ponatinib | -6.36776 | -6.57436 | -42.4936 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Ponatinib | -6.36776 | -6.57436 | -42.4936 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Ponatinib | -6.36776 | -6.57436 | -42.4936 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Lenvatinib | -6.19605 | -6.19605 | -46.3713 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Cabozantinib | -6.08829 | -6.133290000000001 | -42.7376 |
126_CREB3L3_PKN3-DOCK_HTVS_1-001 | Cabozantinib | -6.08829 | -6.133290000000001 | -42.7376 |
Top |
Kinase-Substrate Information of CREB3L3_PKN3 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
PKN3 | Q6P5Z2 | human | EGFR | P00533 | T678 | RHIVRKRtLRRLLQE | |
PKN3 | Q6P5Z2 | human | CLIP1 | P30622 | S312 | AsLKRsPsAssLsSM |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
PKN3 | ID | Description | 0.00e+00 |
PKN3 | GO:0010749 | regulation of nitric oxide mediated signal transduction | 3.00e-02 |
PKN3 | GO:0061029 | eyelid development in camera-type eye | 3.00e-02 |
PKN3 | GO:0070141 | response to UV-A | 3.00e-02 |
PKN3 | GO:1905208 | negative regulation of cardiocyte differentiation | 3.00e-02 |
PKN3 | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity | 3.00e-02 |
PKN3 | GO:0038083 | peptidyl-tyrosine autophosphorylation | 3.00e-02 |
PKN3 | GO:0038128 | ERBB2 signaling pathway | 3.00e-02 |
PKN3 | GO:1904031 | positive regulation of cyclin-dependent protein kinase activity | 3.00e-02 |
PKN3 | GO:0060571 | morphogenesis of an epithelial fold | 3.00e-02 |
PKN3 | GO:0042059 | negative regulation of epidermal growth factor receptor signaling pathway | 3.00e-02 |
PKN3 | GO:0007202 | activation of phospholipase C activity | 3.00e-02 |
PKN3 | GO:0007263 | nitric oxide mediated signal transduction | 3.00e-02 |
PKN3 | GO:0050999 | regulation of nitric-oxide synthase activity | 3.00e-02 |
PKN3 | GO:0007435 | salivary gland morphogenesis | 3.00e-02 |
PKN3 | GO:0031116 | positive regulation of microtubule polymerization | 3.00e-02 |
PKN3 | GO:1901185 | negative regulation of ERBB signaling pathway | 3.00e-02 |
PKN3 | GO:1905207 | regulation of cardiocyte differentiation | 3.00e-02 |
PKN3 | GO:0007431 | salivary gland development | 3.00e-02 |
PKN3 | GO:0031112 | positive regulation of microtubule polymerization or depolymerization | 3.00e-02 |
PKN3 | GO:0010863 | positive regulation of phospholipase C activity | 3.00e-02 |
PKN3 | GO:0071276 | cellular response to cadmium ion | 3.00e-02 |
PKN3 | GO:0045740 | positive regulation of DNA replication | 3.00e-02 |
PKN3 | GO:0071392 | cellular response to estradiol stimulus | 3.00e-02 |
PKN3 | GO:1900274 | regulation of phospholipase C activity | 3.00e-02 |
PKN3 | GO:0071364 | cellular response to epidermal growth factor stimulus | 3.00e-02 |
PKN3 | GO:0032768 | regulation of monooxygenase activity | 3.00e-02 |
PKN3 | GO:0035272 | exocrine system development | 3.00e-02 |
PKN3 | GO:0070849 | response to epidermal growth factor | 3.00e-02 |
PKN3 | GO:0021795 | cerebral cortex cell migration | 3.00e-02 |
PKN3 | GO:0010518 | positive regulation of phospholipase activity | 3.00e-02 |
PKN3 | GO:0048546 | digestive tract morphogenesis | 3.00e-02 |
PKN3 | GO:1900087 | positive regulation of G1/S transition of mitotic cell cycle | 3.00e-02 |
PKN3 | GO:1902895 | positive regulation of miRNA transcription | 3.00e-02 |
PKN3 | GO:0048146 | positive regulation of fibroblast proliferation | 3.00e-02 |
PKN3 | GO:0010517 | regulation of phospholipase activity | 3.00e-02 |
PKN3 | GO:0031122 | cytoplasmic microtubule organization | 3.00e-02 |
PKN3 | GO:0046686 | response to cadmium ion | 3.00e-02 |
PKN3 | GO:0060193 | positive regulation of lipase activity | 3.00e-02 |
PKN3 | GO:0022029 | telencephalon cell migration | 3.00e-02 |
PKN3 | GO:0031113 | regulation of microtubule polymerization | 3.00e-02 |
PKN3 | GO:1903078 | positive regulation of protein localization to plasma membrane | 3.00e-02 |
PKN3 | GO:0042058 | regulation of epidermal growth factor receptor signaling pathway | 3.00e-02 |
PKN3 | GO:0021885 | forebrain cell migration | 3.00e-02 |
PKN3 | GO:2000630 | positive regulation of miRNA metabolic process | 3.00e-02 |
PKN3 | GO:1902808 | positive regulation of cell cycle G1/S phase transition | 3.00e-02 |
PKN3 | GO:1901224 | positive regulation of non-canonical NF-kappaB signal transduction | 3.00e-02 |
PKN3 | GO:1901184 | regulation of ERBB signaling pathway | 3.00e-02 |
PKN3 | GO:1902893 | regulation of miRNA transcription | 3.00e-02 |
PKN3 | GO:0061614 | miRNA transcription | 3.00e-02 |
Top |
Related Drugs to CREB3L3_PKN3 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning CREB3L3-PKN3 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to CREB3L3_PKN3 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |