UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:CRISPLD2_JAK1 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: CRISPLD2_JAK1 | KinaseFusionDB ID: KFG1434 | FusionGDB2.0 ID: KFG1434 | Hgene | Tgene | Gene symbol | CRISPLD2 | JAK1 | Gene ID | 83716 | 3716 | |
Gene name | cysteine rich secretory protein LCCL domain containing 2 | Janus kinase 1 | ||||||||||
Synonyms | CRISP11|LCRISP2|LGL1 | AIIDE|JAK1A|JAK1B|JTK3 | ||||||||||
Cytomap | 16q24.1 | 1p31.3 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | cysteine-rich secretory protein LCCL domain-containing 2CRISP-11LCCL domain-containing cysteine-rich secretory protein 2cysteine-rich secretory protein 11late gestation lung 1testis secretory sperm-binding protein Li 207atrypsin inhibitor | tyrosine-protein kinase JAK1 | ||||||||||
Modification date | 20240403 | 20240411 | ||||||||||
UniProtAcc | Q9H0B8 | P23458 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000262424, ENST00000567845, ENST00000564567, ENST00000566431, ENST00000569090, | ENST00000465376, ENST00000342505, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: CRISPLD2 [Title/Abstract] AND JAK1 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CRISPLD2(84922969)-JAK1(65339206), # samples:1 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | JAK1 | GO:0007259 | cell surface receptor signaling pathway via JAK-STAT | 7657660|8232552|8272873 |
Tgene | JAK1 | GO:0035723 | interleukin-15-mediated signaling pathway | 7568001 |
Tgene | JAK1 | GO:0035771 | interleukin-4-mediated signaling pathway | 7929391 |
Tgene | JAK1 | GO:0038110 | interleukin-2-mediated signaling pathway | 7973659|11909529 |
Tgene | JAK1 | GO:0038113 | interleukin-9-mediated signaling pathway | 8756628 |
Tgene | JAK1 | GO:0038154 | interleukin-11-mediated signaling pathway | 8272872 |
Tgene | JAK1 | GO:0046677 | response to antibiotic | 16280321 |
Tgene | JAK1 | GO:0060333 | type II interferon-mediated signaling pathway | 8232552 |
Tgene | JAK1 | GO:0060337 | type I interferon-mediated signaling pathway | 7532278|8232552 |
Tgene | JAK1 | GO:0070102 | interleukin-6-mediated signaling pathway | 8272873 |
Tgene | JAK1 | GO:1900182 | positive regulation of protein localization to nucleus | 26479788 |
Kinase Fusion gene breakpoints across CRISPLD2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across JAK1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-CD-5798-01A | CRISPLD2 | chr16 | 84922969 | JAK1 | chr1 | 65339206 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000262424 | ENST00000342505 | CRISPLD2 | chr16 | 84922969 | JAK1 | chr1 | 65339206 | 6132 | 1554 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000262424_ENST00000342505_CRISPLD2_chr16_84922969_JAK1_chr1_65339206_length(amino acids)=1554 MEPCGELKRPALPEEPRLPRESHSCCRSGAMSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEIL MLHNKLRGQVQPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWC PERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCYREETY TPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSAVNYMTQVVRCDTKMKDRCKGSTCNRYQCPAGCLNHKAKIFGTLFYESSSS ICRAAIHYGILDDKGGLVDITRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDE PSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDKKKTYVGSLRNGVQSERFYFTNWHGTNDNEQSVWRHSPKKQKNGYEK KKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIR QRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGN LGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIREEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVD GYFRLTADAHHYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEQVQGAQKQFKNFQI EVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLKRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLG RGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMH RKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNL SVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKK PATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGN GIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDD RDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRK -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr16:84922969/chr1:65339206) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
CRISPLD2 | JAK1 |
FUNCTION: Promotes matrix assembly. {ECO:0000250}. | FUNCTION: Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway (PubMed:8232552, PubMed:7615558, PubMed:28111307, PubMed:32750333, PubMed:16239216). Kinase partner for the interleukin (IL)-2 receptor (PubMed:11909529) as well as interleukin (IL)-10 receptor (PubMed:12133952). Kinase partner for the type I interferon receptor IFNAR2 (PubMed:8232552, PubMed:7615558, PubMed:28111307, PubMed:32750333, PubMed:16239216). In response to interferon-binding to IFNAR1-IFNAR2 heterodimer, phosphorylates and activates its binding partner IFNAR2, creating docking sites for STAT proteins (PubMed:7759950). Directly phosphorylates STAT proteins but also activates STAT signaling through the transactivation of other JAK kinases associated with signaling receptors (PubMed:8232552, PubMed:16239216, PubMed:32750333). {ECO:0000269|PubMed:11909529, ECO:0000269|PubMed:12133952, ECO:0000269|PubMed:16239216, ECO:0000269|PubMed:28111307, ECO:0000269|PubMed:32750333, ECO:0000269|PubMed:7615558, ECO:0000269|PubMed:7657660, ECO:0000269|PubMed:8232552}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | CRISPLD2 | 84922969 | JAK1 | 65339206 | ENST00000262424 | 3 | 25 | 583_855 | 109 | 1155 | Domain | Note=Protein kinase 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | CRISPLD2 | 84922969 | JAK1 | 65339206 | ENST00000262424 | 3 | 25 | 875_1153 | 109 | 1155 | Domain | Note=Protein kinase 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | CRISPLD2 | 84922969 | JAK1 | 65339206 | ENST00000262424 | 3 | 25 | 439_544 | 109 | 1155 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>127_CRISPLD2_JAK1 | ENST00000262424 | ENST00000342505 | CRISPLD2 | chr16 | 84922969 | JAK1 | chr1 | 65339206 | MEPCGELKRPALPEEPRLPRESHSCCRSGAMSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEIL MLHNKLRGQVQPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWC PERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCYREETY TPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSAVNYMTQVVRCDTKMKDRCKGSTCNRYQCPAGCLNHKAKIFGTLFYESSSS ICRAAIHYGILDDKGGLVDITRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDE PSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDKKKTYVGSLRNGVQSERFYFTNWHGTNDNEQSVWRHSPKKQKNGYEK KKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIR QRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGN LGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIREEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVD GYFRLTADAHHYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEQVQGAQKQFKNFQI EVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLKRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLG RGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMH RKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNL SVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKK PATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGN GIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDD RDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRK | 1554 |
3D view using mol* of 127_CRISPLD2_JAK1 | ||||||||||
PDB file >>>TKFP_208_CRISPLD2_JAK1 | ENST00000262424 | ENST00000342505 | CRISPLD2 | chr16 | 84922969 | JAK1 | chr1 | 65339206 | MEPCGELKRPALPEEPRLPRESHSCCRSGAMSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEIL MLHNKLRGQVQPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWC PERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCYREETY TPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSAVNYMTQVVRCDTKMKDRCKGSTCNRYQCPAGCLNHKAKIFGTLFYESSSS ICRAAIHYGILDDKGGLVDITRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDE PSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDKKKTYVGSLRNGVQSERFYFTNWHGTNDNEQSVWRHSPKKQKNGYEK KKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIR QRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGN LGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIREEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVD GYFRLTADAHHYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEQVQGAQKQFKNFQI EVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLKRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLG RGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMH RKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNL SVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKK PATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGN GIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDD RDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRK | 1554_CRISPLD2_JAK1 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
127_CRISPLD2_JAK1.png |
127_CRISPLD2_JAK1.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
127_CRISPLD2_JAK1_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Lapatinib | -7.53091 | -7.61971 | -64.194 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Lapatinib | -7.49068 | -7.57948 | -63.3931 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Selumetinib | -6.29823 | -6.30693 | -40.4244 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Selumetinib | -6.29823 | -6.30693 | -40.4244 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Neratinib | -6.18005 | -6.36235 | -55.8634 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Neratinib | -6.18005 | -6.36235 | -55.8634 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Abrocitinib | -6.13811 | -6.14921 | -44.5697 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Abrocitinib | -6.13811 | -6.14921 | -44.5697 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Pralsetinib | -6.11099 | -6.20249 | -57.0791 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Tofacitinib | -5.86463 | -5.87613 | -41.5087 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Tofacitinib | -5.86463 | -5.87613 | -41.5087 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Capmatinib | -5.44814 | -5.45374 | -53.0748 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Netarsudil | -5.44759 | -5.45869 | -54.316 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Netarsudil | -5.44759 | -5.45869 | -54.316 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Infigratinib | -5.43366 | -6.0004599999999995 | -47.8846 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Infigratinib | -5.43366 | -6.0004599999999995 | -47.8846 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Infigratinib | -5.43366 | -6.0004599999999995 | -47.8846 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Regorafenib | -5.4295599999999995 | -5.4295599999999995 | -42.5489 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Larotrectinib | -5.36545 | -5.36545 | -51.6236 |
127_CRISPLD2_JAK1-DOCK_HTVS_1-001 | Tofacitinib | -5.339119999999999 | -5.350619999999999 | -37.53 |
Top |
Kinase-Substrate Information of CRISPLD2_JAK1 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
JAK1 | P23458 | human | SIRT1 | Q96EB6 | Y280 | FRSRDGIyARLAVDF | SIR2 |
JAK1 | P23458 | human | EIF2AK3 | Q9NZJ5 | Y585 | NDIkNSGyISRYLTD | |
JAK1 | P23458 | human | STAT5A | P42229 | Y694 | LAkAVDGyVkPQIkQ | |
JAK1 | P23458 | human | RIPK1 | Q13546 | Y384 | kLQDEANyHLyGsRM | |
JAK1 | P23458 | human | SNX8 | Q9Y5X2 | Y126 | MLLHkFPyRMVPALP | PX |
JAK1 | P23458 | human | MAP3K5 | Q99683 | Y718 | IPERDSRySQPLHEE | Pkinase |
JAK1 | P23458 | human | H3C1 | P68431 | Y41 | GVkkPHryrPGtVAL | Histone |
JAK1 | P23458 | human | EIF2AK3 | Q9NZJ5 | Y619 | NKVDDCNyAIkRIRL | Pkinase |
JAK1 | P23458 | human | SIRT1 | Q96EB6 | Y301 | QAMFDIEyFRKDPRP | SIR2 |
JAK1 | P23458 | human | SNX8 | Q9Y5X2 | Y95 | LFLKHVEyEVSSQRF | |
JAK1 | P23458 | human | CD274 | Q9NZQ7 | Y112 | KLQDAGVyRCMISYG | V-set |
JAK1 | P23458 | human | STAT1 | P42224 | Y701 | DGPkGtGyIktELIs |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
JAK1 | ID | Description | 0.00e+00 |
JAK1 | GO:0042542 | response to hydrogen peroxide | 7.47e-05 |
JAK1 | GO:0001819 | positive regulation of cytokine production | 3.40e-04 |
JAK1 | GO:0000302 | response to reactive oxygen species | 3.40e-04 |
JAK1 | GO:0043124 | negative regulation of canonical NF-kappaB signal transduction | 3.40e-04 |
JAK1 | GO:0071356 | cellular response to tumor necrosis factor | 3.96e-04 |
JAK1 | GO:0070059 | intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress | 3.96e-04 |
JAK1 | GO:0070301 | cellular response to hydrogen peroxide | 3.96e-04 |
JAK1 | GO:0034612 | response to tumor necrosis factor | 4.05e-04 |
JAK1 | GO:0062197 | cellular response to chemical stress | 8.02e-04 |
JAK1 | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process | 1.27e-03 |
JAK1 | GO:0071887 | leukocyte apoptotic process | 1.50e-03 |
JAK1 | GO:0006979 | response to oxidative stress | 1.50e-03 |
JAK1 | GO:2001056 | positive regulation of cysteine-type endopeptidase activity | 1.53e-03 |
JAK1 | GO:0030099 | myeloid cell differentiation | 1.71e-03 |
JAK1 | GO:0034614 | cellular response to reactive oxygen species | 2.20e-03 |
JAK1 | GO:0010950 | positive regulation of endopeptidase activity | 2.20e-03 |
JAK1 | GO:0043281 | regulation of cysteine-type endopeptidase activity involved in apoptotic process | 2.31e-03 |
JAK1 | GO:0031667 | response to nutrient levels | 2.31e-03 |
JAK1 | GO:0010952 | positive regulation of peptidase activity | 2.39e-03 |
JAK1 | GO:0009267 | cellular response to starvation | 2.61e-03 |
JAK1 | GO:0001936 | regulation of endothelial cell proliferation | 2.61e-03 |
JAK1 | GO:2000108 | positive regulation of leukocyte apoptotic process | 2.70e-03 |
JAK1 | GO:2000116 | regulation of cysteine-type endopeptidase activity | 2.97e-03 |
JAK1 | GO:0001935 | endothelial cell proliferation | 3.16e-03 |
JAK1 | GO:1902235 | regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway | 3.32e-03 |
JAK1 | GO:0042594 | response to starvation | 3.65e-03 |
JAK1 | GO:0002573 | myeloid leukocyte differentiation | 4.40e-03 |
JAK1 | GO:0031669 | cellular response to nutrient levels | 5.15e-03 |
JAK1 | GO:0034599 | cellular response to oxidative stress | 5.21e-03 |
JAK1 | GO:0043122 | regulation of canonical NF-kappaB signal transduction | 5.52e-03 |
JAK1 | GO:0034976 | response to endoplasmic reticulum stress | 5.52e-03 |
JAK1 | GO:0042149 | cellular response to glucose starvation | 5.74e-03 |
JAK1 | GO:0051402 | neuron apoptotic process | 5.74e-03 |
JAK1 | GO:0034198 | cellular response to amino acid starvation | 5.74e-03 |
JAK1 | GO:0031668 | cellular response to extracellular stimulus | 5.74e-03 |
JAK1 | GO:0052548 | regulation of endopeptidase activity | 6.00e-03 |
JAK1 | GO:1990928 | response to amino acid starvation | 6.05e-03 |
JAK1 | GO:0007249 | canonical NF-kappaB signal transduction | 6.41e-03 |
JAK1 | GO:0070231 | T cell apoptotic process | 6.58e-03 |
JAK1 | GO:0071375 | cellular response to peptide hormone stimulus | 6.58e-03 |
JAK1 | GO:0052547 | regulation of peptidase activity | 6.58e-03 |
JAK1 | GO:0097300 | programmed necrotic cell death | 6.58e-03 |
JAK1 | GO:0097193 | intrinsic apoptotic signaling pathway | 6.79e-03 |
JAK1 | GO:0008631 | intrinsic apoptotic signaling pathway in response to oxidative stress | 6.92e-03 |
JAK1 | GO:0030225 | macrophage differentiation | 6.99e-03 |
JAK1 | GO:0071496 | cellular response to external stimulus | 8.05e-03 |
JAK1 | GO:0045862 | positive regulation of proteolysis | 8.15e-03 |
JAK1 | GO:0043536 | positive regulation of blood vessel endothelial cell migration | 9.23e-03 |
JAK1 | GO:1901653 | cellular response to peptide | 9.49e-03 |
Top |
Related Drugs to CRISPLD2_JAK1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning CRISPLD2-JAK1 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to CRISPLD2_JAK1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |