UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:DDX5_PRKCB |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: DDX5_PRKCB | KinaseFusionDB ID: KFG1671 | FusionGDB2.0 ID: KFG1671 | Hgene | Tgene | Gene symbol | DDX5 | PRKCB | Gene ID | 1655 | 5579 | |
Gene name | DEAD-box helicase 5 | protein kinase C beta | ||||||||||
Synonyms | G17P1|HLR1|HUMP68|p68 | PKC-beta|PKCB|PKCI(2)|PKCbeta|PRKCB1|PRKCB2 | ||||||||||
Cytomap | 17q23.3 | 16p12.2-p12.1 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | probable ATP-dependent RNA helicase DDX5ATP-dependent RNA helicase DDX5DEAD (Asp-Glu-Ala-Asp) box helicase 5DEAD (Asp-Glu-Ala-Asp) box polypeptide 5DEAD box protein 5DEAD box-5DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase, 68kD)RNA h | protein kinase C beta typePKC-Bprotein kinase C, beta 1 polypeptide | ||||||||||
Modification date | 20240407 | 20240407 | ||||||||||
UniProtAcc | Q9NY93 | P05771 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000225792, ENST00000450599, ENST00000578804, ENST00000580026, | ENST00000482000, ENST00000498058, ENST00000303531, ENST00000321728, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: DDX5 [Title/Abstract] AND PRKCB [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | DDX5(62502192)-PRKCB(24166004), # samples:1 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | DDX5 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 15298701 |
Hgene | DDX5 | GO:0000381 | regulation of alternative mRNA splicing, via spliceosome | 21343338 |
Hgene | DDX5 | GO:0000956 | nuclear-transcribed mRNA catabolic process | 23788676 |
Tgene | PRKCB | GO:0010827 | regulation of glucose transmembrane transport | 25982116 |
Tgene | PRKCB | GO:0043687 | post-translational protein modification | 20228790 |
Kinase Fusion gene breakpoints across DDX5 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across PRKCB (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChiTaRS5.0 | CD683976 | DDX5 | chr17 | 62502192 | PRKCB | chr16 | 24166004 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000225792 | ENST00000321728 | DDX5 | chr17 | 62502192 | PRKCB | chr16 | 24166004 | 1895 | 315 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000225792_ENST00000321728_DDX5_chr17_62502192_PRKCB_chr16_24166004_length(amino acids)=315 MLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFY AAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLA GQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRD -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr17:62502192/chr16:24166004) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
DDX5 | PRKCB |
FUNCTION: Nucleolar RNA helicase that plays a role in various biological processes including innate immunity, ribosome biogenesis or nucleolus organization (PubMed:31340999, PubMed:33789112). Plays an essential role in maintaining nucleolar integrity in planarian stem cells (PubMed:33789112). Maintains embryonic stem cells proliferation by conventional regulation of ribosome assembly and interaction with OCT4 and POU5F1 complex (By similarity). Regulates antiviral innate immunity by inhibiting the virus-triggered signaling nuclear translocation of IRF3 (PubMed:31340999). Mechanistically, acts by disrupting the interaction between IRF3 and importin IPO5 (PubMed:31340999). May play a role in later stages of the processing of the pre-ribosomal particles leading to mature 60S ribosomal subunits. Has intrinsic ATPase activity. {ECO:0000250|UniProtKB:Q9D0R4, ECO:0000269|PubMed:31340999, ECO:0000269|PubMed:33789112}.; FUNCTION: (Microbial infection) Helicase activity is important for packaging viral RNA into virions during West Nile virus infection. {ECO:0000269|PubMed:22925334}.; FUNCTION: (Microbial infection) Plays a positive role in foot-and-mouth disease virus replication by inhibiting the phosphorylation of IRF3 leading to inhibition of type I interferon. {ECO:0000269|PubMed:31445188}.; FUNCTION: (Microbial infection) Plays a positive role in EMCV replication by interrupting IRF3 phosphorylation and its nucleus translocation. {ECO:0000269|PubMed:34922148}. | FUNCTION: Calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase involved in various cellular processes such as regulation of the B-cell receptor (BCR) signalosome, oxidative stress-induced apoptosis, androgen receptor-dependent transcription regulation, insulin signaling and endothelial cells proliferation. Plays a key role in B-cell activation by regulating BCR-induced NF-kappa-B activation. Mediates the activation of the canonical NF-kappa-B pathway (NFKB1) by direct phosphorylation of CARD11/CARMA1 at 'Ser-559', 'Ser-644' and 'Ser-652'. Phosphorylation induces CARD11/CARMA1 association with lipid rafts and recruitment of the BCL10-MALT1 complex as well as MAP3K7/TAK1, which then activates IKK complex, resulting in nuclear translocation and activation of NFKB1. Plays a direct role in the negative feedback regulation of the BCR signaling, by down-modulating BTK function via direct phosphorylation of BTK at 'Ser-180', which results in the alteration of BTK plasma membrane localization and in turn inhibition of BTK activity (PubMed:11598012). Involved in apoptosis following oxidative damage: in case of oxidative conditions, specifically phosphorylates 'Ser-36' of isoform p66Shc of SHC1, leading to mitochondrial accumulation of p66Shc, where p66Shc acts as a reactive oxygen species producer. Acts as a coactivator of androgen receptor (AR)-dependent transcription, by being recruited to AR target genes and specifically mediating phosphorylation of 'Thr-6' of histone H3 (H3T6ph), a specific tag for epigenetic transcriptional activation that prevents demethylation of histone H3 'Lys-4' (H3K4me) by LSD1/KDM1A (PubMed:20228790). In insulin signaling, may function downstream of IRS1 in muscle cells and mediate insulin-dependent DNA synthesis through the RAF1-MAPK/ERK signaling cascade. Participates in the regulation of glucose transport in adipocytes by negatively modulating the insulin-stimulated translocation of the glucose transporter SLC2A4/GLUT4. Phosphorylates SLC2A1/GLUT1, promoting glucose uptake by SLC2A1/GLUT1 (PubMed:25982116). Under high glucose in pancreatic beta-cells, is probably involved in the inhibition of the insulin gene transcription, via regulation of MYC expression. In endothelial cells, activation of PRKCB induces increased phosphorylation of RB1, increased VEGFA-induced cell proliferation, and inhibits PI3K/AKT-dependent nitric oxide synthase (NOS3/eNOS) regulation by insulin, which causes endothelial dysfunction. Also involved in triglyceride homeostasis (By similarity). Phosphorylates ATF2 which promotes cooperation between ATF2 and JUN, activating transcription (PubMed:19176525). Phosphorylates KLHL3 in response to angiotensin II signaling, decreasing the interaction between KLHL3 and WNK4 (PubMed:25313067). {ECO:0000250|UniProtKB:P68404, ECO:0000269|PubMed:11598012, ECO:0000269|PubMed:19176525, ECO:0000269|PubMed:20228790, ECO:0000269|PubMed:25313067, ECO:0000269|PubMed:25982116}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | DDX5 | 62502192 | PRKCB | 24166004 | ENST00000225792 | 0 | 2 | 601_671 | 0 | 58 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Tgene | DDX5 | 62502192 | PRKCB | 24166004 | ENST00000225792 | 8 | 17 | 601_671 | 355 | 672 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Tgene | DDX5 | 62502192 | PRKCB | 24166004 | ENST00000225792 | 8 | 17 | 601_671 | 355 | 674 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Tgene | DDX5 | 62502192 | PRKCB | 24166004 | ENST00000225792 | 0 | 2 | 158_275 | 0 | 58 | Domain | Note=C2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00041 |
Tgene | DDX5 | 62502192 | PRKCB | 24166004 | ENST00000225792 | 0 | 2 | 342_600 | 0 | 58 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>140_DDX5_PRKCB | ENST00000225792 | ENST00000321728 | DDX5 | chr17 | 62502192 | PRKCB | chr16 | 24166004 | MLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFY AAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLA GQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRD | 315 |
3D view using mol* of 140_DDX5_PRKCB | ||||||||||
PDB file >>>TKFP_229_DDX5_PRKCB | ENST00000225792 | ENST00000321728 | DDX5 | chr17 | 62502192 | PRKCB | chr16 | 24166004 | MLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFY AAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLA GQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRD | 315_DDX5_PRKCB |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
140_DDX5_PRKCB.png |
140_DDX5_PRKCB.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
140_DDX5_PRKCB_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Tofacitinib | -7.30742 | -7.318919999999999 | -38.5209 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Tofacitinib | -7.30742 | -7.318919999999999 | -38.5209 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Tepotinib | -7.27555 | -7.27665 | -60.5319 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Lenvatinib | -6.5172099999999995 | -6.5172099999999995 | -48.831 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Larotrectinib | -6.29012 | -6.29012 | -50.7783 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Baricitinib | -6.21013 | -6.21013 | -45.176 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Larotrectinib | -6.12139 | -6.12139 | -49.5528 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Entrectinib | -6.08816 | -6.1528599999999996 | -53.4968 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Entrectinib | -6.08816 | -6.1528599999999996 | -53.4968 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Fedratinib | -6.04403 | -6.09543 | -53.9644 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Fedratinib | -6.04403 | -6.09543 | -53.9644 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Tivozanib | -5.94864 | -5.94864 | -51.4523 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Futibatinib | -5.94161 | -5.94161 | -38.8123 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Asciminib | -5.91416 | -6.37916 | -47.7873 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Afatinib | -5.9106 | -6.0929 | -48.6101 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Afatinib | -5.9106 | -6.0929 | -48.6101 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Afatinib | -5.9092 | -6.0929 | -48.6101 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Larotrectinib | -5.87477 | -5.87477 | -48.1196 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Lapatinib | -5.85559 | -5.94439 | -52.0545 |
140_DDX5_PRKCB-DOCK_HTVS_1-001 | Encorafenib | -5.81493 | -6.20343 | -53.1998 |
Top |
Kinase-Substrate Information of DDX5_PRKCB |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
PRKCB | P05771-2 | human | MAPT | P10636-8 | S352 | DFKDrVQskIGsLDN | Tubulin-binding |
PRKCB | P05771-2 | human | ITGB2 | P05107 | S745 | FEkEKLksQWNNDNP | Integrin_b_cyt |
PRKCB | P05771-2 | human | TRPV1 | Q8NER1 | T705 | WKLQRAItILDTEKS | |
PRKCB | P05771-2 | human | DAB2 | P98082 | S24 | QAAPKAPsKKEKKKG | |
PRKCB | P05771-2 | human | PRKCB | P05771-2 | S660 | QsEFEGFsFVNsEFL | Pkinase_C |
PRKCB | P05771-2 | human | MAPT | P10636-8 | S258 | PDLkNVKskIGstEN | Tubulin-binding |
PRKCB | P05771-2 | human | PPARA | Q07869 | S230 | VKARVILsGKASNNP | |
PRKCB | P05771-2 | human | ATF2 | P15336 | S121 | LAtPIIRsKIEEPSV | |
PRKCB | P05771-2 | human | KIR3DL1 | P43629 | S415 | QRKITRPsQRPKtPP | |
PRKCB | P05771-2 | human | EIF6 | P56537 | S235 | QPstIAtsMRDsLID | |
PRKCB | P05771-2 | human | PTPN11 | Q06124 | S591 | GLMQQQksFR_____ | |
PRKCB | P05771-2 | human | GSK3B | P49841 | S9 | SGRPRttsFAEsCkP | |
PRKCB | P05771-2 | human | MYH9 | P35579 | S1916 | AMNREVssLkNkLRr | Myosin_tail_1 |
PRKCB | P05771-2 | human | RPS6KB2 | Q9UBS0 | S473 | PPSGTKKsKRGRGRP | |
PRKCB | P05771-2 | human | ITGB2 | P05107 | T758 | NPLFksAtttVMNPk | Integrin_b_cyt |
PRKCB | P05771-2 | human | TRPV6 | Q9H1D0 | S184 | LARRAsVsARAtGTA | Ank_2 |
PRKCB | P05771-2 | human | C5AR1 | P21730 | S334 | sVVREsKsFTRsTVD | |
PRKCB | P05771-2 | human | NCF1 | P14598 | S320 | QRsRKRLsQDAYRRN | NECFESHC |
PRKCB | P05771-2 | human | MFN1 | Q8IWA4 | S284 | QNRIFFVsAkEVLsA | |
PRKCB | P05771-2 | human | EIF3A | Q14152 | S1364 | RAEKDREsLRRtKNE | |
PRKCB | P05771-2 | human | LMNB1 | P20700 | S405 | VtVsRAsssRsVRtt | |
PRKCB | P05771-2 | human | SYT6 | Q5T7P8 | T418 | RLKKKKttIKKNTLN | C2 |
PRKCB | P05771-2 | human | MCU | Q8NE86 | S92 | VISVRLPsRRERCQF | |
PRKCB | P05771-2 | human | EIF4G1 | Q04637-8 | S1093 | FAPGGRLsWGKGSSG | |
PRKCB | P05771-2 | human | MFN1 | Q8IWA4 | S290 | VsAkEVLsARKQKAQ | |
PRKCB | P05771-2 | human | PTPN11 | Q06124 | S576 | CAEMREDsARVyENV | |
PRKCB | P05771-2 | human | NCF1 | P14598 | S315 | AHsIHQRsRKRLsQD | NECFESHC |
PRKCB | P05771-2 | human | TRPV6 | Q9H1D0 | T728 | MPSVSRstSRssANW | |
PRKCB | P05771-2 | human | RAB11A | P62491 | S177 | TEIYRIVsQkQMSDR | |
PRKCB | P05771-2 | human | PPARA | Q07869 | S179 | RFGRMPRsEKAKLkA | |
PRKCB | P05771-2 | human | NCF1 | P14598 | S328 | QDAYRRNsVRFLQQR | NECFESHC |
PRKCB | P05771-2 | human | MAPT | P10636-8 | S324 | kVTskCGsLGNIHHk | Tubulin-binding |
PRKCB | P05771-2 | human | TP73 | O15350 | S388 | VPQPLVDsYRQQQQL | |
PRKCB | P05771-2 | human | CHAT | P28329-3 | S476 | HKAAVPAsEKLLLLK | Carn_acyltransf |
PRKCB | P05771-2 | human | LMNB1 | P20700 | S395 | LkLsPsPssRVtVsR | |
PRKCB | P05771-2 | human | CHAT | P28329-3 | S346 | LLKHVTQssRKLIRA | Carn_acyltransf |
PRKCB | P05771-2 | human | CHAT | P28329-3 | S440 | VPTYESAsIRRFQEG | Carn_acyltransf |
PRKCB | P05771-2 | human | FUS | P35637 | S257 | GrGGMGGsDrGGFNk | |
PRKCB | P05771-2 | human | SYT6 | Q5T7P8 | T417 | RRLKKKKttIKKNTL | C2 |
PRKCB | P05771-2 | human | CHAT | P28329-3 | S347 | LKHVTQssRKLIRAD | Carn_acyltransf |
PRKCB | P05771-2 | human | CHAT | P28329-3 | T255 | TVLVKDStNRDSLDM | Carn_acyltransf |
PRKCB | P05771-2 | human | NCF1 | P14598 | S370 | PAVPPRPsADLILNR | p47_phox_C |
PRKCB | P05771-2 | human | NCF1 | P14598 | S303 | RGAPPRRssIRNAHs | NECFESHC |
PRKCB | P05771-2 | human | GHRL | Q9UBU3 | S41 | RVQQRKEsKKPPAKL | Motilin_ghrelin |
PRKCB | P05771-2 | human | MAPT | P10636-8 | S293 | NVQskCGsKDNIkHV | Tubulin-binding |
PRKCB | P05771-2 | human | KCNE1 | P15382 | S102 | VQARVLEsYRSCYVV | ISK_Channel |
PRKCB | P05771-2 | human | NCF1 | P14598 | S359 | EERQtQRsKPQPAVP | p47_phox_C |
PRKCB | P05771-2 | human | NCF1 | P14598 | S304 | GAPPRRssIRNAHsI | NECFESHC |
PRKCB | P05771-2 | human | MFN1 | Q8IWA4 | S86 | AFFGRTSsGKSSVIN | Dynamin_N |
PRKCB | P05771-2 | human | GSK3A | P49840 | S21 | sGrARtssFAEPGGG | |
PRKCB | P05771-2 | human | NCF1 | P14598 | S379 | DLILNRCsEstKRKL | p47_phox_C |
PRKCB | P05771-2 | human | SYT6 | Q5T7P8 | T283 | DRKCKLQtRVHRKTL | C2 |
PRKCB | P05771 | human | ANXA1 | P04083 | S28 | yVQtVksskGGPGsA | |
PRKCB | P05771 | human | MAPT | P10636-8 | S352 | DFKDrVQskIGsLDN | Tubulin-binding |
PRKCB | P05771 | human | ITGB2 | P05107 | S745 | FEkEKLksQWNNDNP | Integrin_b_cyt |
PRKCB | P05771 | human | PRKCB | P05771-2 | S660 | QsEFEGFsFVNsEFL | Pkinase_C |
PRKCB | P05771 | human | PTPN11 | Q06124 | S591 | GLMQQQksFR_____ | |
PRKCB | P05771 | human | MYH9 | P35579 | S1916 | AMNREVssLkNkLRr | Myosin_tail_1 |
PRKCB | P05771 | human | ANXA2 | P07355 | S26 | tPPsAyGsVkAytNF | |
PRKCB | P05771 | human | LIN28B | Q6ZN17 | S243 | EQSKkGPsVQKRKKT | |
PRKCB | P05771 | human | ORAI1 | Q96D31 | S27 | GGSTTsGsRRsRRRs | |
PRKCB | P05771 | human | KCNC4 | Q03721 | S9 | ISSVCVssYRGRKsG | Potassium_chann |
PRKCB | P05771 | human | ITGB2 | P05107 | T758 | NPLFksAtttVMNPk | Integrin_b_cyt |
PRKCB | P05771 | human | PIK3CG | P48736 | S582 | LWHFRYEsLKHPKAY | PI3Ka |
PRKCB | P05771 | human | AKT1 | P31749 | S473 | RPHFPQFsysAsGtA | Pkinase_C |
PRKCB | P05771 | human | NCF1 | P14598 | S320 | QRsRKRLsQDAYRRN | NECFESHC |
PRKCB | P05771 | human | IBTK | Q9P2D0 | S1200 | ASSLHsVsSksFRDF | |
PRKCB | P05771 | human | EPHA2 | P29317 | S892 | ADFDPRVsIRLPsts | |
PRKCB | P05771 | human | KCNC4 | Q03721 | S21 | KsGNKPPsKTCLKEE | Potassium_chann |
PRKCB | P05771 | human | PRKAA1 | Q13131 | S496 | AtPQRsGsVsNyRSC | AdenylateSensor |
PRKCB | P05771 | human | PTPN11 | Q06124 | S576 | CAEMREDsARVyENV | |
PRKCB | P05771 | human | NOX5 | Q96PH1-4 | T494 | KRLsRSVtMRKsQRS | FAD_binding_8 |
PRKCB | P05771 | human | EPB41 | P11171-4 | S312 | QAQTRQAsALIDRPA | FA |
PRKCB | P05771 | human | STMN1 | P16949 | S25 | QAFELILsPrskEsV | Stathmin |
PRKCB | P05771 | human | TYR | P14679 | S527 | DYHsLYQsHL_____ | |
PRKCB | P05771 | human | MAPT | P10636-8 | S324 | kVTskCGsLGNIHHk | Tubulin-binding |
PRKCB | P05771 | human | MARCKS | P29966 | S163 | KRFsFkKsFkLsGFs | MARCKS |
PRKCB | P05771 | human | CHAT | P28329-3 | S440 | VPTYESAsIRRFQEG | Carn_acyltransf |
PRKCB | P05771 | human | STMN1 | P16949 | S38 | sVPEFPLsPPkKkDL | Stathmin |
PRKCB | P05771 | human | MSX2 | P35548 | T135 | HMsPTTCtLRKHKtN | |
PRKCB | P05771 | human | CHAT | P28329-3 | S347 | LKHVTQssRKLIRAD | Carn_acyltransf |
PRKCB | P05771 | human | CHAT | P28329-3 | T255 | TVLVKDStNRDSLDM | Carn_acyltransf |
PRKCB | P05771 | human | TYR | P14679 | S523 | MEKEDYHsLYQsHL_ | |
PRKCB | P05771 | human | MAPT | P10636-8 | S293 | NVQskCGsKDNIkHV | Tubulin-binding |
PRKCB | P05771 | human | NCF1 | P14598 | S304 | GAPPRRssIRNAHsI | NECFESHC |
PRKCB | P05771 | human | SHC1 | P29353 | T206 | VPGAkGAtRRRKPCs | PID |
PRKCB | P05771 | human | GSK3A | P49840 | S21 | sGrARtssFAEPGGG | |
PRKCB | P05771 | human | IBTK | Q9P2D0 | S1203 | LHsVsSksFRDFLLE | |
PRKCB | P05771 | human | TRPM8 | Q7Z2W7 | S1040 | CKEKNMEssVCCFKN | |
PRKCB | P05771 | human | MARCKS | P29966 | S159 | kkKKKRFsFkKsFkL | MARCKS |
PRKCB | P05771 | human | NOX5 | Q96PH1-4 | S498 | RSVtMRKsQRSsKGS | FAD_binding_8 |
PRKCB | P05771 | human | GRN | P28799 | S81 | IFTVSGTsSCCPFPE | Granulin |
PRKCB | P05771 | human | SHC1 | P29353 | S213 | tRRRKPCsRPLSSIL | PID |
PRKCB | P05771 | human | MAPT | P10636-8 | S258 | PDLkNVKskIGstEN | Tubulin-binding |
PRKCB | P05771 | human | KCNC4 | Q03721 | S8 | MISSVCVssYRGRKs | Potassium_chann |
PRKCB | P05771 | human | ATF2 | P15336 | S121 | LAtPIIRsKIEEPSV | |
PRKCB | P05771 | human | GSK3B | P49841 | S9 | SGRPRttsFAEsCkP | |
PRKCB | P05771 | human | OCLN | Q16625 | S490 | RLKQVkGsADYKSKK | Occludin_ELL |
PRKCB | P05771 | human | RPS6KB2 | Q9UBS0 | S473 | PPSGTKKsKRGRGRP | |
PRKCB | P05771 | human | ORAI1 | Q96D31 | S30 | TTsGsRRsRRRsGDG | |
PRKCB | P05771 | human | MSX2 | P35548 | T141 | CtLRKHKtNRKPRTP | |
PRKCB | P05771 | human | CFLAR | O15519-2 | S193 | LQAAIQKsLKDPSNN | |
PRKCB | P05771 | human | C5AR1 | P21730 | S334 | sVVREsKsFTRsTVD | |
PRKCB | P05771 | human | KCNC4 | Q03721 | S15 | ssYRGRKsGNKPPsK | Potassium_chann |
PRKCB | P05771 | human | CLDN1 | O95832 | T191 | CSCPRkTtsYPtPRP | |
PRKCB | P05771 | human | KLHL3 | Q9UH77 | S433 | PMNTRRSsVGVGVVE | Kelch_1 |
PRKCB | P05771 | human | IRS1 | P35568 | S323 | MVGGKPGsFRVRAss | |
PRKCB | P05771 | human | SHC1 | P29353 | S139 | EEWTRHGsFVNkPtR | |
PRKCB | P05771 | human | NCF1 | P14598 | S315 | AHsIHQRsRKRLsQD | NECFESHC |
PRKCB | P05771 | human | CFLAR | O15519 | S193 | LQAAIQksLkDPSNN | |
PRKCB | P05771 | human | TRPM8 | Q7Z2W7 | S1041 | KEKNMEssVCCFKNE | |
PRKCB | P05771 | human | NCF1 | P14598 | S328 | QDAYRRNsVRFLQQR | NECFESHC |
PRKCB | P05771 | human | CHAT | P28329-3 | S476 | HKAAVPAsEKLLLLK | Carn_acyltransf |
PRKCB | P05771 | human | CHAT | P28329-3 | S346 | LLKHVTQssRKLIRA | Carn_acyltransf |
PRKCB | P05771 | human | ILF3 | Q12906 | S647 | rGrGRGGsIRGRGRG | |
PRKCB | P05771 | human | H3C1 | P68431 | T6 | __ArtkQtArkstGG | Histone |
PRKCB | P05771 | human | FCER1G | P30273 | S69 | DGVytGLstRNQEty | ITAM |
PRKCB | P05771 | human | IRS1 | P35568 | S441 | SPCDFRSsFRsVtPD | |
PRKCB | P05771 | human | ACSL4 | O60488 | T328 | LAHVLELtAEISCFT | AMP-binding |
PRKCB | P05771 | human | AKT1 | P31749 | T308 | kDGAtMKtFCGtPEy | Pkinase |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
PRKCB | ID | Description | 0.00e+00 |
PRKCB | GO:0043434 | response to peptide hormone | 6.72e-08 |
PRKCB | GO:1903829 | positive regulation of protein localization | 1.29e-07 |
PRKCB | GO:0032868 | response to insulin | 3.59e-07 |
PRKCB | GO:0008286 | insulin receptor signaling pathway | 2.13e-06 |
PRKCB | GO:0097284 | hepatocyte apoptotic process | 2.13e-06 |
PRKCB | GO:0032869 | cellular response to insulin stimulus | 4.55e-06 |
PRKCB | GO:0046879 | hormone secretion | 8.73e-06 |
PRKCB | GO:0071375 | cellular response to peptide hormone stimulus | 8.73e-06 |
PRKCB | GO:0009914 | hormone transport | 1.02e-05 |
PRKCB | GO:0002790 | peptide secretion | 1.27e-05 |
PRKCB | GO:0046883 | regulation of hormone secretion | 1.37e-05 |
PRKCB | GO:0015833 | peptide transport | 1.81e-05 |
PRKCB | GO:0010827 | regulation of glucose transmembrane transport | 2.50e-05 |
PRKCB | GO:0030073 | insulin secretion | 2.60e-05 |
PRKCB | GO:1901653 | cellular response to peptide | 2.70e-05 |
PRKCB | GO:0023061 | signal release | 2.82e-05 |
PRKCB | GO:1903532 | positive regulation of secretion by cell | 2.82e-05 |
PRKCB | GO:0043467 | regulation of generation of precursor metabolites and energy | 2.82e-05 |
PRKCB | GO:0046887 | positive regulation of hormone secretion | 2.95e-05 |
PRKCB | GO:0045834 | positive regulation of lipid metabolic process | 3.39e-05 |
PRKCB | GO:1903828 | negative regulation of protein localization | 3.49e-05 |
PRKCB | GO:0051222 | positive regulation of protein transport | 3.89e-05 |
PRKCB | GO:0051047 | positive regulation of secretion | 3.90e-05 |
PRKCB | GO:0001774 | microglial cell activation | 3.90e-05 |
PRKCB | GO:0042060 | wound healing | 4.85e-05 |
PRKCB | GO:0002269 | leukocyte activation involved in inflammatory response | 4.85e-05 |
PRKCB | GO:1904951 | positive regulation of establishment of protein localization | 4.85e-05 |
PRKCB | GO:0002274 | myeloid leukocyte activation | 5.41e-05 |
PRKCB | GO:0030072 | peptide hormone secretion | 5.41e-05 |
PRKCB | GO:0050796 | regulation of insulin secretion | 5.43e-05 |
PRKCB | GO:0032386 | regulation of intracellular transport | 5.72e-05 |
PRKCB | GO:0006816 | calcium ion transport | 6.04e-05 |
PRKCB | GO:0061900 | glial cell activation | 6.04e-05 |
PRKCB | GO:0019216 | regulation of lipid metabolic process | 6.04e-05 |
PRKCB | GO:0006887 | exocytosis | 6.94e-05 |
PRKCB | GO:0035265 | organ growth | 7.07e-05 |
PRKCB | GO:0046324 | regulation of glucose import | 7.07e-05 |
PRKCB | GO:0042886 | amide transport | 7.20e-05 |
PRKCB | GO:0050994 | regulation of lipid catabolic process | 7.28e-05 |
PRKCB | GO:0051098 | regulation of binding | 7.36e-05 |
PRKCB | GO:1904659 | glucose transmembrane transport | 8.83e-05 |
PRKCB | GO:0006109 | regulation of carbohydrate metabolic process | 9.31e-05 |
PRKCB | GO:0008645 | hexose transmembrane transport | 9.76e-05 |
PRKCB | GO:0015749 | monosaccharide transmembrane transport | 1.10e-04 |
PRKCB | GO:0090276 | regulation of peptide hormone secretion | 1.11e-04 |
PRKCB | GO:0046626 | regulation of insulin receptor signaling pathway | 1.15e-04 |
PRKCB | GO:0002791 | regulation of peptide secretion | 1.17e-04 |
PRKCB | GO:0005979 | regulation of glycogen biosynthetic process | 1.17e-04 |
PRKCB | GO:0010962 | regulation of glucan biosynthetic process | 1.17e-04 |
Top |
Related Drugs to DDX5_PRKCB |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning DDX5-PRKCB and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to DDX5_PRKCB |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |