UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:DNAH1_PRKCD |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: DNAH1_PRKCD | KinaseFusionDB ID: KFG1709 | FusionGDB2.0 ID: KFG1709 | Hgene | Tgene | Gene symbol | DNAH1 | PRKCD | Gene ID | 25981 | 5580 | |
Gene name | dynein axonemal heavy chain 1 | protein kinase C delta | ||||||||||
Synonyms | CILD37|DNAHC1|HDHC7|HL-11|HL11|HSRF-1|SPGF18|XLHSRF-1 | ALPS3|CVID9|MAY1|PKCD|nPKC-delta | ||||||||||
Cytomap | 3p21.1 | 3p21.1 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | dynein axonemal heavy chain 1axonemal beta dynein heavy chain 1ciliary dynein heavy chain 1dynein heavy chain 1, axonemaldynein, axonemal, heavy polypeptide 1heat shock regulated protein 1testicular tissue protein Li 60 | protein kinase C delta typeprotein kinase C delta VIIItyrosine-protein kinase PRKCD | ||||||||||
Modification date | 20240411 | 20240403 | ||||||||||
UniProtAcc | Q0VDD8 | Q969G5 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000420323, ENST00000466628, | ENST00000477794, ENST00000330452, ENST00000394729, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: DNAH1 [Title/Abstract] AND PRKCD [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | DNAH1(52391751)-PRKCD(53221356), # samples:2 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | DNAH1 | GO:0036159 | inner dynein arm assembly | 24360805 |
Tgene | PRKCD | GO:0006468 | protein phosphorylation | 10713049|12649167|16611985|34593629 |
Tgene | PRKCD | GO:0006915 | apoptotic process | 10770950|12649167 |
Tgene | PRKCD | GO:0018105 | peptidyl-serine phosphorylation | 18285462 |
Tgene | PRKCD | GO:0018107 | peptidyl-threonine phosphorylation | 10770950 |
Tgene | PRKCD | GO:0032147 | activation of protein kinase activity | 10713049 |
Tgene | PRKCD | GO:0034644 | cellular response to UV | 17303575 |
Tgene | PRKCD | GO:0042119 | neutrophil activation | 10770950 |
Tgene | PRKCD | GO:0043687 | post-translational protein modification | 19059439 |
Tgene | PRKCD | GO:0070301 | cellular response to hydrogen peroxide | 10713049 |
Tgene | PRKCD | GO:0071447 | cellular response to hydroperoxide | 19059439 |
Tgene | PRKCD | GO:1904385 | cellular response to angiotensin | 18285462 |
Tgene | PRKCD | GO:2000303 | regulation of ceramide biosynthetic process | 17303575 |
Kinase Fusion gene breakpoints across DNAH1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across PRKCD (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-24-1603-01A | DNAH1 | chr3 | 52391751 | PRKCD | chr3 | 53221356 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000420323 | ENST00000394729 | DNAH1 | chr3 | 52391751 | PRKCD | chr3 | 53221356 | 5371 | 1577 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000420323_ENST00000394729_DNAH1_chr3_52391751_PRKCD_chr3_53221356_length(amino acids)=1577 MDSGKVAPPSGLEGSFGWGISLRSSMEQPNSKGYSLGRTPQGPECSSAPAVQVGTHRGLEYNPGKILPGSDYGLGNPPALDPKLPHLPLP PAPPTLSDLGQPRKSPLTGTDKKYPLMKQRGFYSDILSPGTLDQLGEVCRGPRMSQNLLRQADLDKFTPRVGSFEVPEDFQERMEQQCIG STTRLLAQTDFPLQAYEPKMQVPFQVLPGQHPRKIEIERRKQQYLSLDIEQLLFSQGIDSNKLMPRHLDHQHPQTIEQGHDPIFPIYLPL KVFDNEDFDCRTPREWINMGLEPGSLDRKPVPGKALLPTDDFLGHEDPKSQKLKYKWCEVGVLDYDEEKKLYLVHKTDEKGLVRDEMGRP ILNAGVTTEGRPPLQVCQYWVPRIQLLFCAEDPCMFAQRVVQANALRKNTEALLLYNLYVDCMPSDGQHVISEQSLSKIKQWALSTPRMR KGPSVLEHLSSLAREVSLDYERSMNKINFDHVVSSKPETFSYVTLPKKEEEQVPERGLVSVPKYHFWEQKEDFTFVSLLTRPEVITALSK VRAECNKVTAMSLFHSSLSKYSHLEEFEQIQSQTFSQVQMFLKDSWISSLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLRKLMELVKY MLQDTLRFLVQDSLASFSQFISDTCCSVLNCTDDMVWGDDLINSPYRPRKNPLFIMDLVLDSSGVHYSTPLEQFEASLLNLFDKGILATH AVPQLEKLVMEDIFISGDPLLESVGLHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNNNDIASFLKTYQTQGLLAQEVREVVLT HLREKEILDSSLPSSIIIGPFYINTDNVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELREWMKGIP ERLVGLEERIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSI HVEISRAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEK NVVEAFKTMHKCVKQFKDMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQDHIESI SKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLE EWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAF PRFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLY EMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRD -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr3:52391751/chr3:53221356) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
DNAH1 | PRKCD |
FUNCTION: Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Involved in sperm motility; implicated in sperm flagellar assembly (By similarity). {ECO:0000250}. | FUNCTION: Regulates the traffic and/or budding of caveolae (PubMed:19262564). Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in smooth muscle but not in the lung and heart endothelial cells. Regulates the equilibrium between cell surface-associated and cell surface-dissociated caveolae by promoting the rapid release of caveolae from the cell surface. Plays a role in the regulation of the circadian clock. Modulates the period length and phase of circadian gene expression and also regulates expression and interaction of the core clock components PER1/2 and CRY1/2 (By similarity). {ECO:0000250|UniProtKB:Q91VJ2, ECO:0000250|UniProtKB:Q9Z1H9, ECO:0000269|PubMed:19262564}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | DNAH1 | 52391751 | PRKCD | 53221356 | ENST00000420323 | 12 | 18 | 604_675 | 450 | 677 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Tgene | DNAH1 | 52391751 | PRKCD | 53221356 | ENST00000420323 | 13 | 19 | 604_675 | 450 | 677 | Domain | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>144_DNAH1_PRKCD | ENST00000420323 | ENST00000394729 | DNAH1 | chr3 | 52391751 | PRKCD | chr3 | 53221356 | MDSGKVAPPSGLEGSFGWGISLRSSMEQPNSKGYSLGRTPQGPECSSAPAVQVGTHRGLEYNPGKILPGSDYGLGNPPALDPKLPHLPLP PAPPTLSDLGQPRKSPLTGTDKKYPLMKQRGFYSDILSPGTLDQLGEVCRGPRMSQNLLRQADLDKFTPRVGSFEVPEDFQERMEQQCIG STTRLLAQTDFPLQAYEPKMQVPFQVLPGQHPRKIEIERRKQQYLSLDIEQLLFSQGIDSNKLMPRHLDHQHPQTIEQGHDPIFPIYLPL KVFDNEDFDCRTPREWINMGLEPGSLDRKPVPGKALLPTDDFLGHEDPKSQKLKYKWCEVGVLDYDEEKKLYLVHKTDEKGLVRDEMGRP ILNAGVTTEGRPPLQVCQYWVPRIQLLFCAEDPCMFAQRVVQANALRKNTEALLLYNLYVDCMPSDGQHVISEQSLSKIKQWALSTPRMR KGPSVLEHLSSLAREVSLDYERSMNKINFDHVVSSKPETFSYVTLPKKEEEQVPERGLVSVPKYHFWEQKEDFTFVSLLTRPEVITALSK VRAECNKVTAMSLFHSSLSKYSHLEEFEQIQSQTFSQVQMFLKDSWISSLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLRKLMELVKY MLQDTLRFLVQDSLASFSQFISDTCCSVLNCTDDMVWGDDLINSPYRPRKNPLFIMDLVLDSSGVHYSTPLEQFEASLLNLFDKGILATH AVPQLEKLVMEDIFISGDPLLESVGLHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNNNDIASFLKTYQTQGLLAQEVREVVLT HLREKEILDSSLPSSIIIGPFYINTDNVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELREWMKGIP ERLVGLEERIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSI HVEISRAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEK NVVEAFKTMHKCVKQFKDMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQDHIESI SKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLE EWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAF PRFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLY EMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRD | 1577 |
3D view using mol* of 144_DNAH1_PRKCD | ||||||||||
PDB file >>>TKFP_237_DNAH1_PRKCD | ENST00000420323 | ENST00000394729 | DNAH1 | chr3 | 52391751 | PRKCD | chr3 | 53221356 | MDSGKVAPPSGLEGSFGWGISLRSSMEQPNSKGYSLGRTPQGPECSSAPAVQVGTHRGLEYNPGKILPGSDYGLGNPPALDPKLPHLPLP PAPPTLSDLGQPRKSPLTGTDKKYPLMKQRGFYSDILSPGTLDQLGEVCRGPRMSQNLLRQADLDKFTPRVGSFEVPEDFQERMEQQCIG STTRLLAQTDFPLQAYEPKMQVPFQVLPGQHPRKIEIERRKQQYLSLDIEQLLFSQGIDSNKLMPRHLDHQHPQTIEQGHDPIFPIYLPL KVFDNEDFDCRTPREWINMGLEPGSLDRKPVPGKALLPTDDFLGHEDPKSQKLKYKWCEVGVLDYDEEKKLYLVHKTDEKGLVRDEMGRP ILNAGVTTEGRPPLQVCQYWVPRIQLLFCAEDPCMFAQRVVQANALRKNTEALLLYNLYVDCMPSDGQHVISEQSLSKIKQWALSTPRMR KGPSVLEHLSSLAREVSLDYERSMNKINFDHVVSSKPETFSYVTLPKKEEEQVPERGLVSVPKYHFWEQKEDFTFVSLLTRPEVITALSK VRAECNKVTAMSLFHSSLSKYSHLEEFEQIQSQTFSQVQMFLKDSWISSLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLRKLMELVKY MLQDTLRFLVQDSLASFSQFISDTCCSVLNCTDDMVWGDDLINSPYRPRKNPLFIMDLVLDSSGVHYSTPLEQFEASLLNLFDKGILATH AVPQLEKLVMEDIFISGDPLLESVGLHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNNNDIASFLKTYQTQGLLAQEVREVVLT HLREKEILDSSLPSSIIIGPFYINTDNVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELREWMKGIP ERLVGLEERIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSI HVEISRAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEK NVVEAFKTMHKCVKQFKDMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQDHIESI SKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLE EWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAF PRFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLY EMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRD | 1577_DNAH1_PRKCD |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of DNAH1_PRKCD |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
PRKCD | Q05655 | human | HDAC5 | Q9UQL6 | S259 | FPLRkTAsEPNLKVR | |
PRKCD | Q05655 | human | PTPRA | P18433-2 | S204 | PLLARSPsTNRKYPP | |
PRKCD | Q05655 | human | BCL2 | P10415 | S70 | RDPVARtsPLQtPAA | |
PRKCD | Q05655 | human | HNRNPK | P61978 | S302 | GrGGrGGsrArNLPL | |
PRKCD | Q05655 | human | SLC9A1 | P19634 | S648 | KTRQRLRsYNRHtLV | NEXCaM_BD |
PRKCD | Q05655 | human | SHOC2 | Q9UQ13 | T71 | VAFSVDNtIKRPNPA | |
PRKCD | Q05655 | human | BLVRA | P53004 | S237 | sFHFksGsLENVPNV | Biliv-reduc_cat |
PRKCD | Q05655 | human | MUC1 | P15941 | T1224 | RyVPPsstDRsPyEK | |
PRKCD | Q05655 | human | ADD1 | P35611 | S726 | KKKFRtPsFLKKsKK | |
PRKCD | Q05655 | human | NCF1 | P14598 | S370 | PAVPPRPsADLILNR | p47_phox_C |
PRKCD | Q05655 | human | FBXO25 | Q8TCJ0 | S178 | DLLQDLSsTLCILIR | |
PRKCD | Q05655 | human | ENOX2 | Q16206 | S504 | ENLKEKEsCASRLCA | |
PRKCD | Q05655 | human | MARK2 | Q7KZI7 | T596 | rGVssRstFHAGQLR | |
PRKCD | Q05655 | human | TNNI3 | P19429 | T143 | RGKFKRPtLRrVrIs | Troponin |
PRKCD | Q05655 | human | FOSL1 | P15407 | T217 | LEPEALHtPTLMTtP | |
PRKCD | Q05655 | human | BEST1 | O76090 | S358 | SAQFRRAsFMGSTFN | |
PRKCD | Q05655 | human | RPS6KB2 | Q9UBS0 | S473 | PPSGTKKsKRGRGRP | |
PRKCD | Q05655 | human | NCF4 | Q15080 | S315 | RQARGLPsQKRLFPW | PB1 |
PRKCD | Q05655 | human | NCF1 | P14598 | S303 | RGAPPRRssIRNAHs | NECFESHC |
PRKCD | Q05655 | human | CARD9 | Q9H257 | T231 | CKVERKHtLKLRHAM | |
PRKCD | Q05655 | human | ITGB2 | P05107 | T758 | NPLFksAtttVMNPk | Integrin_b_cyt |
PRKCD | Q05655 | human | PRKCD | Q05655 | T218 | TAANSRDtIFQkERF | |
PRKCD | Q05655 | human | TRPV4 | Q9HBA0 | S162 | FDIVSRGsTADLDGL | |
PRKCD | Q05655 | human | LCP1 | P13796 | S5 | ___MARGsVsDEEMM | |
PRKCD | Q05655 | human | SQSTM1 | Q13501 | S349 | sskEVDPstGELQsL | |
PRKCD | Q05655 | human | KRT8 | P05787 | S74 | tVNQsLLsPLVLEVD | Keratin_2_head |
PRKCD | Q05655 | human | GAPDH | P04406 | T246 | NVsVVDLtCrLEkPA | Gp_dh_C |
PRKCD | Q05655 | human | GAPDH | P04406 | S241 | rVPtANVsVVDLtCr | Gp_dh_C |
PRKCD | Q05655 | human | NRG1 | Q02297-6 | S286 | LHDRLRQsLRSERNN | Neuregulin |
PRKCD | Q05655 | human | NCF1 | P14598 | S328 | QDAYRRNsVRFLQQR | NECFESHC |
PRKCD | Q05655 | human | DAP3 | P51398 | S31 | MGTQARQsIAAHLDN | |
PRKCD | Q05655 | human | STAT1 | P42224 | S727 | TDNLLPMsPEEFDEV | STAT1_TAZ2bind |
PRKCD | Q05655 | human | NCF4 | Q15080 | T154 | LRRLRPRtRKVKSVs | |
PRKCD | Q05655 | human | PRKCD | Q05655 | S503 | kENIFGEsRAstFCG | Pkinase |
PRKCD | Q05655 | human | RPS6 | P62753 | S235 | IAKRRRLssLRAsts | |
PRKCD | Q05655 | human | ITGB2 | P05107 | S745 | FEkEKLksQWNNDNP | Integrin_b_cyt |
PRKCD | Q05655 | human | PRKCD | Q05655 | S299 | NQVtQRAsRRsDsAs | |
PRKCD | Q05655 | human | SLC29A1 | Q99808 | S281 | QPTNESHsIkAILkN | Nucleoside_tran |
PRKCD | Q05655 | human | TIRAP | P58753 | Y106 | AAQDLVSyLEGSTAS | TIR_2 |
PRKCD | Q05655 | human | DAP3 | P51398 | S280 | tLKREDksPIAPEEL | DAP3 |
PRKCD | Q05655 | human | CTTN | Q14247 | S405 | KtQtPPVsPAPQPtE | |
PRKCD | Q05655 | human | DAB2 | P98082 | S24 | QAAPKAPsKKEKKKG | |
PRKCD | Q05655 | human | PTPN22 | Q9Y2R2 | S35 | FLkLkRQsTKYKADK | |
PRKCD | Q05655 | human | PRKD1 | Q15139 | S742 | GEksFRRsVVGtPAy | Pkinase |
PRKCD | Q05655 | human | PRKCD | Q05655 | S302 | tQRAsRRsDsAssEP | |
PRKCD | Q05655 | human | NCF1 | P14598 | S348 | PGPQsPGsPLEEERQ | |
PRKCD | Q05655 | human | BLVRA | P53004 | S230 | LKRNRyLsFHFksGs | Biliv-reduc_cat |
PRKCD | Q05655 | human | PRKCD | Q05655 | S645 | LNEkARLsysDKNLI | Pkinase_C |
PRKCD | Q05655 | human | DAP3 | P51398 | T237 | ItRVRNAtDAVGIVL | DAP3 |
PRKCD | Q05655 | human | PRKCD | Q05655 | S304 | RAsRRsDsAssEPVG | |
PRKCD | Q05655 | human | FGF1 | P05230 | S131 | VGLKKNGsCKRGPRT | FGF |
PRKCD | Q05655 | human | PRKCD | Q05655 | T295 | AEALNQVtQRAsRRs | |
PRKCD | Q05655 | human | SMPD1 | P17405 | S510 | DGNYSGSsHVVLDHE | ASMase_C |
PRKCD | Q05655 | human | H3C1 | P68431 | T45 | PHryrPGtVALrEIR | Histone |
PRKCD | Q05655 | human | CHAT | P28329-3 | S476 | HKAAVPAsEKLLLLK | Carn_acyltransf |
PRKCD | Q05655 | human | CYBA | P13498 | T147 | ERPQIGGtIkQPPsN | Cytochrom_B558a |
PRKCD | Q05655 | human | PTPRA | P18433-2 | S180 | QAGSHSNsFRLSNGR | |
PRKCD | Q05655 | human | TP53 | P04637 | S46 | AMDDLMLsPDDIEQW | TAD2 |
PRKCD | Q05655 | human | PGR | P06401 | S400 | GAEAsARsPRSYLVA | Prog_receptor |
PRKCD | Q05655 | human | PREX1 | Q8TCU6 | S313 | RVtGsKKsTKRTKsI | |
PRKCD | Q05655 | human | ADAM17 | P78536 | T735 | kPFPAPQtPGRLQPA | |
PRKCD | Q05655 | human | CDH1 | P12830 | T790 | TRNDVAPtLMsVPRy | |
PRKCD | Q05655 | human | C5AR1 | P21730 | S334 | sVVREsKsFTRsTVD | |
PRKCD | Q05655 | human | IRS1 | P35568 | S574 | RLPGHRHsAFVPTRs | |
PRKCD | Q05655 | human | PLSCR3 | Q9NRY6 | T21 | PPPPYPVtPGYPEPA | |
PRKCD | Q05655 | human | NADK | O95544 | S46 | RGRAKsrsLsAsPAL | |
PRKCD | Q05655 | human | TRPV4 | Q9HBA0 | T175 | GLLPFLLtHKKRLTD | |
PRKCD | Q05655 | human | PPP1R14A | Q96A00 | T38 | QkRHARVtVkYDRRE | PP1_inhibitor |
PRKCD | Q05655 | human | NCF1 | P14598 | S320 | QRsRKRLsQDAYRRN | NECFESHC |
PRKCD | Q05655 | human | NCF1 | P14598 | S359 | EERQtQRsKPQPAVP | p47_phox_C |
PRKCD | Q05655 | human | G6PD | P11413-3 | S210 | FGRDLQSsDRLSNHI | G6PD_N |
PRKCD | Q05655 | human | NADK | O95544 | S64 | kEFRRtRsLHGPCPV | |
PRKCD | Q05655 | human | CDK5 | Q00535 | T77 | LHsDkKLtLVFEFCD | Pkinase |
PRKCD | Q05655 | human | LIMK2 | P53671 | S283 | EGtLRRRsLRRsNsI | |
PRKCD | Q05655 | human | DAP3 | P51398 | S185 | FDQPLEAstWLkNFk | DAP3 |
PRKCD | Q05655 | human | NR2F6 | P10588 | S83 | CKSFFKRsIRRNLsY | zf-C4 |
PRKCD | Q05655 | human | NCF1 | P14598 | S304 | GAPPRRssIRNAHsI | NECFESHC |
PRKCD | Q05655 | human | HVCN1 | Q96D96-4 | S77 | GMLRKLFsSHRFQVI | |
PRKCD | Q05655 | human | TNNI3 | P19429 | S23 | PAPIRRRssNyRAyA | Troponin-I_N |
PRKCD | Q05655 | human | IRS1 | P35568 | S323 | MVGGKPGsFRVRAss | |
PRKCD | Q05655 | human | IL6ST | P40189 | T890 | GQVERFEtVGMEAAt | |
PRKCD | Q05655 | human | DAP3 | P51398 | T186 | DQPLEAstWLkNFkT | DAP3 |
PRKCD | Q05655 | human | PRKCD | Q05655 | T141 | EDEAkFPtMNRRGAI | |
PRKCD | Q05655 | human | RPS3 | P23396 | S6 | __MAVQIskkRkFVA | |
PRKCD | Q05655 | human | PRKD1 | Q15139 | S738 | ARIIGEksFRRsVVG | Pkinase |
PRKCD | Q05655 | human | PLD2 | O14939 | T566 | FIQRWNFtKTTKAKy | |
PRKCD | Q05655 | human | BAG3 | O95817 | S187 | sSSSSSAsLPsSGRs | |
PRKCD | Q05655 | human | MCU | Q8NE86 | S92 | VISVRLPsRRERCQF | |
PRKCD | Q05655 | human | CHAT | P28329-3 | S440 | VPTYESAsIRRFQEG | Carn_acyltransf |
PRKCD | Q05655 | human | FOSL1 | P15407 | T227 | LMTtPSLtPFtPSLV | |
PRKCD | Q05655 | human | SHC1 | P29353-2 | S29 | EEWTRHGsFVNKPTR | |
PRKCD | Q05655 | human | EGFR | P00533 | T678 | RHIVRKRtLRRLLQE | |
PRKCD | Q05655 | human | ELAVL1 | Q15717 | S318 | GDkILQVsFkTNkSH | |
PRKCD | Q05655 | human | RPS6 | P62753 | S236 | AKRRRLssLRAstsK | |
PRKCD | Q05655 | human | NFE2L2 | Q16236 | S40 | SREVFDFsQRRkEYE | |
PRKCD | Q05655 | human | HAX1 | O00165 | S210 | QPkSYFksIsVtkIT | |
PRKCD | Q05655 | human | RPS3 | P23396 | T221 | kDEILPttPIsEQkG | |
PRKCD | Q05655 | human | CTNNB1 | P35222 | S715 | GYRQDDPsyRsFHsG | |
PRKCD | Q05655 | human | PRKD1 | Q15139 | S412 | PLMRVVQsVKHTKRK | |
PRKCD | Q05655 | human | IRS1 | P35568 | S307 | TRRsRtEsItAtsPA | |
PRKCD | Q05655 | human | GSK3A | P49840 | S21 | sGrARtssFAEPGGG | |
PRKCD | Q05655 | human | CXCR4 | P61073 | S324 | LtsVsRGssLkILsk | |
PRKCD | Q05655 | human | HVCN1 | Q96D96-4 | T9 | SKFLRHFtVVGDDYH | |
PRKCD | Q05655 | human | TNNI3 | P19429 | S24 | APIRRRssNyRAyAt | Troponin-I_N |
PRKCD | Q05655 | human | PPP1R14B | Q96C90 | T57 | VRRQGKVtVkYDRKE | PP1_inhibitor |
PRKCD | Q05655 | human | TSC2 | P49815 | S939 | sFRARstsLNERPKs | |
PRKCD | Q05655 | human | FCER1G | P30273 | S69 | DGVytGLstRNQEty | ITAM |
PRKCD | Q05655 | human | TBL1XR1 | Q9BZK7 | S123 | AAAsQQGsAKNGENT | |
PRKCD | Q05655 | human | GSK3B | P49841 | S9 | SGRPRttsFAEsCkP | |
PRKCD | Q05655 | human | STAT3 | P40763 | S727 | NtIDLPMsPrTLDSL | |
PRKCD | Q05655 | human | CXCR4 | P61073 | S325 | tsVsRGssLkILskG | |
PRKCD | Q05655 | human | DNM1L | O00429 | S616 | PIPIMPAsPQKGHAV | |
PRKCD | Q05655 | human | TRPV4 | Q9HBA0 | S189 | DEEFREPsTGKTCLP | |
PRKCD | Q05655 | human | EP300 | Q09472 | S89 | SELLRSGsSPNLNMG | |
PRKCD | Q05655 | human | TSC2 | P49815 | S932 | DDtPEkDsFRARsts | |
PRKCD | Q05655 | human | LMNA | P02545 | S22 | QAsstPLsPtRItRL | |
PRKCD | Q05655 | human | FLI1 | Q01543 | T312 | TNGEFKMtDPDEVAR | Ets |
PRKCD | Q05655 | human | MET | P08581 | S985 | PHLDRLVsARsVsPt | |
PRKCD | Q05655 | human | ELAVL1 | Q15717 | S221 | QAQrFrFsPMGVDHM | |
PRKCD | Q05655 | human | IRS1 | P35568 | S441 | SPCDFRSsFRsVtPD | |
PRKCD | Q05655 | human | TACSTD2 | P09758 | S322 | GELRkEPsL______ | |
PRKCD | Q05655 | human | BLVRA | P53004 | S33 | DLRNPHPsSAFLNLI | GFO_IDH_MocA |
PRKCD | Q05655 | human | PA2G4 | Q9UQ80 | S360 | ELkALLQssAsRKtQ | |
PRKCD | Q05655 | human | HVCN1 | Q96D96 | T29 | SKFLRHFtVVGDDyH | |
PRKCD | Q05655 | human | CAT | P04040 | S167 | LFPSFIHsQKRNPQT | Catalase |
PRKCD | Q05655 | human | TP73 | O15350-2 | S289 | GQVLGRRsFEGRICA | P53 |
PRKCD | Q05655 | human | SRC | P12931 | S12 | KSKPKDAsQRRRsLE | |
PRKCD | Q05655 | human | G6PD | P11413-3 | T266 | NIACVILtFKEPFGT | G6PD_C |
PRKCD | Q05655 | human | CHN2 | P52757 | S171 | EKVsRRLsRsKNEPR | |
PRKCD | Q05655 | human | PEBP1 | P30086 | S153 | RGKFkVAsFRKKYEL | PBP |
PRKCD | Q05655 | human | SHOC2 | Q9UQ13 | S297 | GLRYNRLsAIPRSLA | LRR_8 |
PRKCD | Q05655 | human | NCF1 | P14598 | S315 | AHsIHQRsRKRLsQD | NECFESHC |
PRKCD | Q05655 | human | BLVRA | P53004 | S21 | VGVGRAGsVRMRDLR | GFO_IDH_MocA |
PRKCD | Q05655 | human | NCF1 | P14598 | S379 | DLILNRCsEstKRKL | p47_phox_C |
PRKCD | Q05655 | human | RASGRP3 | Q8IV61 | T133 | YDWMRRVtQRKKVSK | |
PRKCD | Q05655 | human | HVCN1 | Q96D96 | S97 | GMLRKLFsSHRFQVI |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
PRKCD | ID | Description | 0.00e+00 |
PRKCD | GO:1901653 | cellular response to peptide | 3.02e-10 |
PRKCD | GO:0010506 | regulation of autophagy | 8.59e-10 |
PRKCD | GO:0010821 | regulation of mitochondrion organization | 5.80e-09 |
PRKCD | GO:0043434 | response to peptide hormone | 6.55e-09 |
PRKCD | GO:0034504 | protein localization to nucleus | 6.55e-09 |
PRKCD | GO:0071375 | cellular response to peptide hormone stimulus | 6.55e-09 |
PRKCD | GO:0006935 | chemotaxis | 1.84e-08 |
PRKCD | GO:0042330 | taxis | 1.84e-08 |
PRKCD | GO:0043254 | regulation of protein-containing complex assembly | 2.92e-08 |
PRKCD | GO:0009410 | response to xenobiotic stimulus | 4.41e-08 |
PRKCD | GO:0000302 | response to reactive oxygen species | 5.28e-08 |
PRKCD | GO:0006606 | protein import into nucleus | 5.58e-08 |
PRKCD | GO:0051170 | import into nucleus | 6.64e-08 |
PRKCD | GO:0060326 | cell chemotaxis | 6.64e-08 |
PRKCD | GO:0032868 | response to insulin | 6.92e-08 |
PRKCD | GO:0006979 | response to oxidative stress | 8.72e-08 |
PRKCD | GO:1903829 | positive regulation of protein localization | 1.00e-07 |
PRKCD | GO:0051347 | positive regulation of transferase activity | 1.25e-07 |
PRKCD | GO:0072593 | reactive oxygen species metabolic process | 1.40e-07 |
PRKCD | GO:0006801 | superoxide metabolic process | 2.26e-07 |
PRKCD | GO:0051222 | positive regulation of protein transport | 2.58e-07 |
PRKCD | GO:0031334 | positive regulation of protein-containing complex assembly | 2.75e-07 |
PRKCD | GO:0034599 | cellular response to oxidative stress | 3.07e-07 |
PRKCD | GO:0062197 | cellular response to chemical stress | 3.20e-07 |
PRKCD | GO:0032869 | cellular response to insulin stimulus | 3.68e-07 |
PRKCD | GO:1904951 | positive regulation of establishment of protein localization | 3.84e-07 |
PRKCD | GO:0006913 | nucleocytoplasmic transport | 4.45e-07 |
PRKCD | GO:0051169 | nuclear transport | 4.45e-07 |
PRKCD | GO:0032386 | regulation of intracellular transport | 5.33e-07 |
PRKCD | GO:0033674 | positive regulation of kinase activity | 5.34e-07 |
PRKCD | GO:0033157 | regulation of intracellular protein transport | 7.81e-07 |
PRKCD | GO:0001666 | response to hypoxia | 1.27e-06 |
PRKCD | GO:0000422 | autophagy of mitochondrion | 1.58e-06 |
PRKCD | GO:0061726 | mitochondrion disassembly | 1.58e-06 |
PRKCD | GO:1900180 | regulation of protein localization to nucleus | 1.87e-06 |
PRKCD | GO:0042542 | response to hydrogen peroxide | 1.90e-06 |
PRKCD | GO:0050921 | positive regulation of chemotaxis | 1.97e-06 |
PRKCD | GO:0036293 | response to decreased oxygen levels | 1.97e-06 |
PRKCD | GO:0097193 | intrinsic apoptotic signaling pathway | 2.18e-06 |
PRKCD | GO:1903146 | regulation of autophagy of mitochondrion | 2.18e-06 |
PRKCD | GO:0032388 | positive regulation of intracellular transport | 2.40e-06 |
PRKCD | GO:0042554 | superoxide anion generation | 2.42e-06 |
PRKCD | GO:2001233 | regulation of apoptotic signaling pathway | 2.62e-06 |
PRKCD | GO:0043410 | positive regulation of MAPK cascade | 2.62e-06 |
PRKCD | GO:0034614 | cellular response to reactive oxygen species | 2.77e-06 |
PRKCD | GO:0031330 | negative regulation of cellular catabolic process | 2.95e-06 |
PRKCD | GO:0090316 | positive regulation of intracellular protein transport | 3.29e-06 |
PRKCD | GO:0042771 | intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator | 3.29e-06 |
PRKCD | GO:0070482 | response to oxygen levels | 3.89e-06 |
Top |
Related Drugs to DNAH1_PRKCD |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning DNAH1-PRKCD and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to DNAH1_PRKCD |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |