UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:EML1_ABL1 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: EML1_ABL1 | KinaseFusionDB ID: KFG1963 | FusionGDB2.0 ID: KFG1963 | Hgene | Tgene | Gene symbol | EML1 | ABL1 | Gene ID | 2009 | 25 | |
Gene name | EMAP like 1 | ABL proto-oncogene 1, non-receptor tyrosine kinase | ||||||||||
Synonyms | BH|ELP79|EMAP|EMAP-1|EMAPL | ABL|BCR-ABL|CHDSKM|JTK7|bcr/abl|c-ABL|c-ABL1|p150|v-abl | ||||||||||
Cytomap | 14q32.2 | 9q34.12 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | echinoderm microtubule-associated protein-like 1echinoderm microtubule associated protein like 1 | tyrosine-protein kinase ABL1ABL protooncogene 1 nonreceptor tyrosine kinaseAbelson tyrosine-protein kinase 1BCR-ABL1 p190BCR/ABL e8a2 fusionBCR/ABL1 e1a2 fusion proteinbcr/c-abl oncogene proteinc-abl oncogene 1, receptor tyrosine kinaseproto-oncog | ||||||||||
Modification date | 20240407 | 20240416 | ||||||||||
UniProtAcc | O00423 | P00519 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000262233, ENST00000327921, ENST00000334192, ENST00000556758, | ENST00000318560, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: EML1 [Title/Abstract] AND ABL1 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | ABL1 | GO:0006974 | DNA damage response | 15657060 |
Tgene | ABL1 | GO:0018108 | peptidyl-tyrosine phosphorylation | 7590236|9144171|10713049|11121037 |
Tgene | ABL1 | GO:0042770 | signal transduction in response to DNA damage | 9037071|15657060|18280240 |
Tgene | ABL1 | GO:0043065 | positive regulation of apoptotic process | 9037071 |
Tgene | ABL1 | GO:0046777 | protein autophosphorylation | 10713049 |
Tgene | ABL1 | GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | 15657060 |
Tgene | ABL1 | GO:0051353 | positive regulation of oxidoreductase activity | 12893824 |
Tgene | ABL1 | GO:0051444 | negative regulation of ubiquitin-protein transferase activity | 20823226 |
Tgene | ABL1 | GO:0070301 | cellular response to hydrogen peroxide | 10713049 |
Tgene | ABL1 | GO:0071103 | DNA conformation change | 9558345 |
Tgene | ABL1 | GO:0071901 | negative regulation of protein serine/threonine kinase activity | 11121037 |
Tgene | ABL1 | GO:1990051 | activation of protein kinase C activity | 10713049 |
Tgene | ABL1 | GO:2000042 | negative regulation of double-strand break repair via homologous recombination | 9461559 |
Kinase Fusion gene breakpoints across EML1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across ABL1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerKB3 | . | EML1 | chr14 | 100387214 | ABL1 | chr9 | 133729450 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000327921 | ENST00000318560 | EML1 | chr14 | 100387214 | ABL1 | chr9 | 133729450 | 8270 | 1767 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000327921_ENST00000318560_EML1_chr14_100387214_ABL1_chr9_133729450_length(amino acids)=1767 MPPASPLGGGAAGRLTQGRPGLLSSASRRLDDSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPT KARPLMQTLPLRTTVNNGTVLPKKPTGSLPSPSGVRKETAVPATKRLNRSVSLLNACKLNRSTPSNIKRTSSSERVSPGGRRESNGDSRG NRNRTGSTSSSSSGKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPT GETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAF SKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLC VTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIRTVAEGK GDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGT LTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSIT KGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYH YRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKK YSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEY LEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGI DLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTR TSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFRE MDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRF LRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIME SSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLS RLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPS TLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDS -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr14:/chr9:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
EML1 | ABL1 |
FUNCTION: Modulates the assembly and organization of the microtubule cytoskeleton, and probably plays a role in regulating the orientation of the mitotic spindle and the orientation of the plane of cell division. Required for normal proliferation of neuronal progenitor cells in the developing brain and for normal brain development. Does not affect neuron migration per se. {ECO:0000250|UniProtKB:Q05BC3}. | FUNCTION: Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DNA damage response and apoptosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like WASF3 (involved in branch formation); ANXA1 (involved in membrane anchoring); DBN1, DBNL, CTTN, RAPH1 and ENAH (involved in signaling); or MAPT and PXN (microtubule-binding proteins). Phosphorylation of WASF3 is critical for the stimulation of lamellipodia formation and cell migration. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as BCAR1, CRK, CRKL, DOK1, EFS or NEDD9 (PubMed:22810897). Phosphorylates multiple receptor tyrosine kinases and more particularly promotes endocytosis of EGFR, facilitates the formation of neuromuscular synapses through MUSK, inhibits PDGFRB-mediated chemotaxis and modulates the endocytosis of activated B-cell receptor complexes. Other substrates which are involved in endocytosis regulation are the caveolin (CAV1) and RIN1. Moreover, ABL1 regulates the CBL family of ubiquitin ligases that drive receptor down-regulation and actin remodeling. Phosphorylation of CBL leads to increased EGFR stability. Involved in late-stage autophagy by regulating positively the trafficking and function of lysosomal components. ABL1 targets to mitochondria in response to oxidative stress and thereby mediates mitochondrial dysfunction and cell death. In response to oxidative stress, phosphorylates serine/threonine kinase PRKD2 at 'Tyr-717' (PubMed:28428613). ABL1 is also translocated in the nucleus where it has DNA-binding activity and is involved in DNA-damage response and apoptosis. Many substrates are known mediators of DNA repair: DDB1, DDB2, ERCC3, ERCC6, RAD9A, RAD51, RAD52 or WRN. Activates the proapoptotic pathway when the DNA damage is too severe to be repaired. Phosphorylates TP73, a primary regulator for this type of damage-induced apoptosis. Phosphorylates the caspase CASP9 on 'Tyr-153' and regulates its processing in the apoptotic response to DNA damage. Phosphorylates PSMA7 that leads to an inhibition of proteasomal activity and cell cycle transition blocks. ABL1 acts also as a regulator of multiple pathological signaling cascades during infection. Several known tyrosine-phosphorylated microbial proteins have been identified as ABL1 substrates. This is the case of A36R of Vaccinia virus, Tir (translocated intimin receptor) of pathogenic E.coli and possibly Citrobacter, CagA (cytotoxin-associated gene A) of H.pylori, or AnkA (ankyrin repeat-containing protein A) of A.phagocytophilum. Pathogens can highjack ABL1 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1. Regulates T-cell differentiation in a TBX21-dependent manner (By similarity). Positively regulates chemokine-mediated T-cell migration, polarization, and homing to lymph nodes and immune-challenged tissues, potentially via activation of NEDD9/HEF1 and RAP1 (By similarity). Phosphorylates TBX21 on tyrosine residues leading to an enhancement of its transcriptional activator activity (By similarity). {ECO:0000250|UniProtKB:P00520, ECO:0000269|PubMed:10391250, ECO:0000269|PubMed:11971963, ECO:0000269|PubMed:12379650, ECO:0000269|PubMed:12531427, ECO:0000269|PubMed:12672821, ECO:0000269|PubMed:15031292, ECO:0000269|PubMed:15556646, ECO:0000269|PubMed:15657060, ECO:0000269|PubMed:15886098, ECO:0000269|PubMed:16424036, ECO:0000269|PubMed:16678104, ECO:0000269|PubMed:16943190, ECO:0000269|PubMed:17306540, ECO:0000269|PubMed:17623672, ECO:0000269|PubMed:18328268, ECO:0000269|PubMed:18945674, ECO:0000269|PubMed:19891780, ECO:0000269|PubMed:20357770, ECO:0000269|PubMed:20417104, ECO:0000269|PubMed:22810897, ECO:0000269|PubMed:28428613, ECO:0000269|PubMed:9037071, ECO:0000269|PubMed:9144171, ECO:0000269|PubMed:9461559}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | EML1 | 100387214 | ABL1 | 133729450 | ENST00000327921 | 0 | 11 | 242_493 | 26 | 1131 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | EML1 | 100387214 | ABL1 | 133729450 | ENST00000327921 | 0 | 11 | 127_217 | 26 | 1131 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Tgene | EML1 | 100387214 | ABL1 | 133729450 | ENST00000327921 | 0 | 11 | 61_121 | 26 | 1131 | Domain | Note=SH3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00192 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>159_EML1_ABL1 | ENST00000327921 | ENST00000318560 | EML1 | chr14 | 100387214 | ABL1 | chr9 | 133729450 | MPPASPLGGGAAGRLTQGRPGLLSSASRRLDDSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPT KARPLMQTLPLRTTVNNGTVLPKKPTGSLPSPSGVRKETAVPATKRLNRSVSLLNACKLNRSTPSNIKRTSSSERVSPGGRRESNGDSRG NRNRTGSTSSSSSGKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPT GETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAF SKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLC VTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIRTVAEGK GDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGT LTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSIT KGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYH YRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKK YSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEY LEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGI DLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTR TSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFRE MDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRF LRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIME SSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLS RLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPS TLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDS | 1767 |
3D view using mol* of 159_EML1_ABL1 | ||||||||||
PDB file >>>TKFP_254_EML1_ABL1 | ENST00000327921 | ENST00000318560 | EML1 | chr14 | 100387214 | ABL1 | chr9 | 133729450 | MPPASPLGGGAAGRLTQGRPGLLSSASRRLDDSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPT KARPLMQTLPLRTTVNNGTVLPKKPTGSLPSPSGVRKETAVPATKRLNRSVSLLNACKLNRSTPSNIKRTSSSERVSPGGRRESNGDSRG NRNRTGSTSSSSSGKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPT GETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAF SKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLC VTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIRTVAEGK GDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGT LTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSIT KGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYH YRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKK YSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEY LEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGI DLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTR TSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFRE MDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRF LRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIME SSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLS RLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPS TLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDS | 1767_EML1_ABL1 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Abstract of the Multiple Sequence Alignment of the Longest Fusion Protein Sequence and Known Sequence from PDB Search Using Fusion Gene Names |
Multiple Sequence Alignment of the Longest Fusion Protein Sequence and Known Sequence from PDB Search Using Fusion Gene Names |
Superimpose the 3D Structures Between the Longest Fusion Protein and the Longest Known PDB |
3D view using mol* of viewer/superimpose_pdbs/EML1_ABL1_4CGB_superimposed.pdb.html | ||||||||||
3D view using mol* of viewer/superimpose_pdbs/EML1_ABL1_4CGC_superimposed.pdb.html |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
159_EML1_ABL1.png |
159_EML1_ABL1.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Binding site residues of the found PDBs. |
PDB accession | AA sequence | Residue position |
4CGB | GLU | 14 |
4CGB | VAL | 15 |
4CGB | ASP | 16 |
4CGB | ASP | 17 |
4CGB | ARG | 18 |
4CGB | VAL | 19 |
4CGB | SER | 20 |
4CGB | ALA | 21 |
4CGB | LEU | 22 |
4CGB | GLU | 23 |
4CGB | GLN | 24 |
4CGB | ARG | 25 |
4CGB | LEU | 26 |
4CGB | GLN | 27 |
4CGB | LEU | 28 |
4CGB | GLN | 29 |
4CGB | GLU | 30 |
4CGB | ASP | 31 |
4CGB | GLU | 32 |
4CGB | LEU | 33 |
4CGB | ALA | 34 |
4CGB | VAL | 35 |
4CGB | LEU | 36 |
4CGB | LYS | 37 |
4CGB | ALA | 38 |
4CGB | ALA | 39 |
4CGB | LEU | 40 |
4CGB | ALA | 41 |
4CGB | ASP | 42 |
4CGB | ALA | 43 |
4CGB | LEU | 44 |
4CGB | ARG | 45 |
4CGB | ARG | 46 |
4CGB | LEU | 47 |
4CGB | ARG | 48 |
4CGB | ALA | 49 |
4CGB | CYS | 50 |
4CGB | GLU | 51 |
4CGB | GLU | 52 |
4CGB | GLN | 53 |
4CGB | GLY | 54 |
4CGB | ALA | 55 |
4CGB | ALA | 56 |
4CGB | LEU | 57 |
4CGB | GLU | 14 |
4CGB | VAL | 15 |
4CGB | ASP | 16 |
4CGB | ASP | 17 |
4CGB | ARG | 18 |
4CGB | VAL | 19 |
4CGB | SER | 20 |
4CGB | ALA | 21 |
4CGB | LEU | 22 |
4CGB | GLU | 23 |
4CGB | GLN | 24 |
4CGB | ARG | 25 |
4CGB | LEU | 26 |
4CGB | GLN | 27 |
4CGB | LEU | 28 |
4CGB | GLN | 29 |
4CGB | GLU | 30 |
4CGB | ASP | 31 |
4CGB | GLU | 32 |
4CGB | LEU | 33 |
4CGB | ALA | 34 |
4CGB | VAL | 35 |
4CGB | LEU | 36 |
4CGB | LYS | 37 |
4CGB | ALA | 38 |
4CGB | ALA | 39 |
4CGB | LEU | 40 |
4CGB | ALA | 41 |
4CGB | ASP | 42 |
4CGB | ALA | 43 |
4CGB | LEU | 44 |
4CGB | ARG | 45 |
4CGB | ARG | 46 |
4CGB | LEU | 47 |
4CGB | ARG | 48 |
4CGB | ALA | 49 |
4CGB | CYS | 50 |
4CGB | GLU | 51 |
4CGB | GLU | 52 |
4CGB | GLN | 53 |
4CGB | GLY | 54 |
4CGB | ALA | 55 |
4CGB | ALA | 56 |
4CGB | LEU | 57 |
4CGB | ARG | 58 |
4CGB | MET | 13 |
4CGB | GLU | 14 |
4CGB | VAL | 15 |
4CGB | ASP | 16 |
4CGB | ASP | 17 |
4CGB | ARG | 18 |
4CGB | VAL | 19 |
4CGB | SER | 20 |
4CGB | ALA | 21 |
4CGB | LEU | 22 |
4CGB | GLU | 23 |
4CGB | GLN | 24 |
4CGB | ARG | 25 |
4CGB | LEU | 26 |
4CGB | GLN | 27 |
4CGB | LEU | 28 |
4CGB | GLN | 29 |
4CGB | GLU | 30 |
4CGB | ASP | 31 |
4CGB | GLU | 32 |
4CGB | LEU | 33 |
4CGB | ALA | 34 |
4CGB | VAL | 35 |
4CGB | LEU | 36 |
4CGB | LYS | 37 |
4CGB | ALA | 38 |
4CGB | ALA | 39 |
4CGB | LEU | 40 |
4CGB | ALA | 41 |
4CGB | ASP | 42 |
4CGB | ALA | 43 |
4CGB | LEU | 44 |
4CGB | ARG | 45 |
4CGB | ARG | 46 |
4CGB | LEU | 47 |
4CGB | ARG | 48 |
4CGB | ALA | 49 |
4CGB | CYS | 50 |
4CGB | GLU | 51 |
4CGB | GLU | 52 |
4CGB | GLN | 53 |
4CGB | MET | 13 |
4CGB | GLU | 14 |
4CGB | VAL | 15 |
4CGB | ASP | 16 |
4CGB | ASP | 17 |
4CGB | ARG | 18 |
4CGB | VAL | 19 |
4CGB | SER | 20 |
4CGB | ALA | 21 |
4CGB | LEU | 22 |
4CGB | GLU | 23 |
4CGB | GLN | 24 |
4CGB | ARG | 25 |
4CGB | LEU | 26 |
4CGB | GLN | 27 |
4CGB | LEU | 28 |
4CGB | GLN | 29 |
4CGB | GLU | 30 |
4CGB | ASP | 31 |
4CGB | GLU | 32 |
4CGB | LEU | 33 |
4CGB | ALA | 34 |
4CGB | VAL | 35 |
4CGB | LEU | 36 |
4CGB | LYS | 37 |
4CGB | ALA | 38 |
4CGB | ALA | 39 |
4CGB | LEU | 40 |
4CGB | ALA | 41 |
4CGB | ASP | 42 |
4CGB | ALA | 43 |
4CGB | LEU | 44 |
4CGB | ARG | 45 |
4CGB | ARG | 46 |
4CGB | LEU | 47 |
4CGB | ARG | 48 |
4CGB | ALA | 49 |
4CGB | CYS | 50 |
4CGB | GLU | 51 |
4CGB | GLU | 52 |
4CGB | GLN | 53 |
4CGB | GLY | 54 |
4CGB | ALA | 55 |
4CGB | ALA | 56 |
4CGB | LEU | 57 |
4CGB | GLU | 14 |
4CGB | VAL | 15 |
4CGB | ASP | 16 |
4CGB | ASP | 17 |
4CGB | ARG | 18 |
4CGB | VAL | 19 |
4CGB | SER | 20 |
4CGB | ALA | 21 |
4CGB | LEU | 22 |
4CGB | GLU | 23 |
4CGB | GLN | 24 |
4CGB | ARG | 25 |
4CGB | LEU | 26 |
4CGB | GLN | 27 |
4CGB | LEU | 28 |
4CGB | GLN | 29 |
4CGB | GLU | 30 |
4CGB | ASP | 31 |
4CGB | GLU | 32 |
4CGB | LEU | 33 |
4CGB | ALA | 34 |
4CGB | VAL | 35 |
4CGB | LEU | 36 |
4CGB | LYS | 37 |
4CGB | ALA | 38 |
4CGB | ALA | 39 |
4CGB | LEU | 40 |
4CGB | ALA | 41 |
4CGB | ASP | 42 |
4CGB | ALA | 43 |
4CGB | LEU | 44 |
4CGB | ARG | 45 |
4CGB | ARG | 46 |
4CGB | LEU | 47 |
4CGB | ARG | 48 |
4CGB | ALA | 49 |
4CGB | CYS | 50 |
4CGB | GLU | 51 |
4CGB | GLU | 52 |
4CGB | MET | 13 |
4CGB | GLU | 14 |
4CGB | VAL | 15 |
4CGB | ASP | 16 |
4CGB | ASP | 17 |
4CGB | ARG | 18 |
4CGB | VAL | 19 |
4CGB | SER | 20 |
4CGB | ALA | 21 |
4CGB | LEU | 22 |
4CGB | GLU | 23 |
4CGB | GLN | 24 |
4CGB | ARG | 25 |
4CGB | LEU | 26 |
4CGB | GLN | 27 |
4CGB | LEU | 28 |
4CGB | GLN | 29 |
4CGB | GLU | 30 |
4CGB | ASP | 31 |
4CGB | GLU | 32 |
4CGB | LEU | 33 |
4CGB | ALA | 34 |
4CGB | VAL | 35 |
4CGB | LEU | 36 |
4CGB | LYS | 37 |
4CGB | ALA | 38 |
4CGB | ALA | 39 |
4CGB | LEU | 40 |
4CGB | ALA | 41 |
4CGB | ASP | 42 |
4CGB | ALA | 43 |
4CGB | LEU | 44 |
4CGB | ARG | 45 |
4CGB | ARG | 46 |
4CGB | LEU | 47 |
4CGB | ARG | 48 |
4CGB | ALA | 49 |
4CGB | CYS | 50 |
4CGB | GLU | 51 |
4CGB | GLU | 52 |
4CGB | GLN | 53 |
4CGB | GLY | 54 |
4CGB | ALA | 55 |
4CGB | ALA | 56 |
4CGB | LEU | 57 |
4CGC | GLU | 35 |
4CGC | GLN | 34 |
4CGC | GLU | 37 |
4CGC | THR | 39 |
4CGC | LEU | 41 |
4CGC | ASP | 36 |
4CGC | VAL | 40 |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
159_EML1_ABL1_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
159_EML1_ABL1-DOCK_HTVS_1-001 | Crizotinib | -5.346430000000001 | -5.8423300000000005 | -46.1271 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Crizotinib | -5.346430000000001 | -5.8423300000000005 | -46.1271 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Lapatinib | -5.17279 | -5.26159 | -57.1493 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Imatinib | -5.14272 | -5.34932 | -52.0779 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Imatinib | -5.14272 | -5.34932 | -52.0779 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Imatinib | -5.14272 | -5.34932 | -52.0779 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Acalabrutinib | -5.0830400000000004 | -5.0971400000000004 | -49.578 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Acalabrutinib | -5.0830400000000004 | -5.0971400000000004 | -49.578 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Lapatinib | -5.0633099999999995 | -5.1521099999999995 | -56.6577 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Netarsudil | -4.940980000000001 | -4.9520800000000005 | -49.5602 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Netarsudil | -4.940980000000001 | -4.9520800000000005 | -49.5602 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Mobocertinib | -4.61581 | -4.62351 | -60.9364 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Tofacitinib | -4.586469999999999 | -4.59797 | -30.5359 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Tofacitinib | -4.586469999999999 | -4.59797 | -30.5359 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Netarsudil | -4.55196 | -4.56306 | -49.4485 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Netarsudil | -4.55196 | -4.56306 | -49.4485 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Ponatinib | -4.46441 | -4.67101 | -49.4995 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Ponatinib | -4.46441 | -4.67101 | -49.4995 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Ponatinib | -4.46441 | -4.67101 | -49.4995 |
159_EML1_ABL1-DOCK_HTVS_1-001 | Capmatinib | -4.37769 | -4.383290000000001 | -45.8208 |
Top |
Kinase-Substrate Information of EML1_ABL1 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
ABL1 | P00519 | human | YAP1 | P46937 | Y407 | sGLsMsSySVPRtPD | |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | Y750 | PAPDELVyQVPQStQ | |
ABL1 | P00519 | human | SMAD4 | Q13485 | Y301 | MPPHPGHyWPVHNEL | |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | S657 | GDyQRPHsAQPADRG | |
ABL1 | P00519 | human | TBX21 | Q9UL17 | Y305 | QFIAVTAyQNAEITQ | T-box |
ABL1 | P00519 | human | CAT | P04040 | Y231 | NANGEAVyCkFHYkT | Catalase |
ABL1 | P00519 | human | MYLK | Q15746 | Y1449 | EKEPEVDyRTVTINT | |
ABL1 | P00519 | human | ABL1 | P00519 | Y393 | RLMtGDtytAHAGAk | PK_Tyr_Ser-Thr |
ABL1 | P00519 | human | TP73 | O15350 | Y99 | SVPTHSPyAQPSSTF | |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | Y715 | PPPLVGtyNtLLsRt | |
ABL1 | P00519 | human | SORBS2 | O94875-2 | Y59 | RPFSPSAySLPASLN | |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | Y565 | KKkTEGtyDLPyWDR | |
ABL1 | P00519 | human | CDC73 | Q6P1J9 | Y315 | KIDTMGTyHGMTLkS | |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | S695 | THPGTsDsysAPRDC | |
ABL1 | P00519 | human | MET | P08581 | Y1349 | stFIGEHyVHVNAty | |
ABL1 | P00519 | human | HRAS | P01112 | Y137 | AQDLARSyGIPYIEt | Ras |
ABL1 | P00519 | human | MYC | P01106 | Y89 | sGLCsPSyVAVtPFs | Myc_N |
ABL1 | P00519 | human | MDM4 | O15151 | Y55 | TVKEVMHyLGQYIMV | SWIB |
ABL1 | P00519 | human | PIK3AP1 | Q6ZUJ8 | Y513 | LGQEEDVyHTVDDDE | |
ABL1 | P00519 | human | PDGFRB | P09619 | Y970 | GEGYKKKyQQVDEEF | |
ABL1 | P00519 | human | KAT5 | Q92993 | Y294 | HPPGNEIyRkGTISF | MOZ_SAS |
ABL1 | P00519 | human | MYC | P01106 | Y47 | CDEEENFyQQQQQSE | Myc_N |
ABL1 | P00519 | human | CRK | P46108 | Y221 | GGPEPGPyAQPsVNt | |
ABL1 | P00519 | human | CASP9 | P55211 | Y153 | RGNADLAyILSMEPC | |
ABL1 | P00519 | human | PLSCR1 | O15162 | Y69 | PVPNQPVyNQPVyNQ | |
ABL1 | P00519 | human | ANXA1 | P04083 | Y21 | IENEEQEyVQtVkss | |
ABL1 | P00519 | human | PXN | P49023 | Y118 | VGEEEHVysFPNkQk | Paxillin |
ABL1 | P00519 | human | SMAD4 | Q13485 | Y195 | NRASTETyStPALLA | |
ABL1 | P00519 | human | ROBO1 | Q9Y6N7 | Y1038 | MLPESTVyGDVDLSN | |
ABL1 | P00519 | human | CRKL | P46109 | Y207 | IPEPAHAyAQPQttt | |
ABL1 | P00519 | human | VAV1 | P15498 | Y174 | EAEGDEIyEDLMRsE | |
ABL1 | P00519 | human | TP63 | Q9H3D4 | Y290 | RQSVLVPyEPPQVGT | P53 |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | T756 | VyQVPQStQEVsGAG | |
ABL1 | P00519 | human | RB1 | P06400 | Y805 | rIPGGNIyIsPLksP | Rb_C |
ABL1 | P00519 | human | NOX5 | Q96PH1 | Y476 | FHYRPGDyLyLNIPT | FAD_binding_8 |
ABL1 | P00519 | human | FHL2 | Q14192 | Y176 | ITTGGVtyREQPWHK | LIM |
ABL1 | P00519 | human | MDM2 | Q00987 | Y394 | QsQESEDysQPSTSS | |
ABL1 | P00519 | human | ESR1 | P03372 | Y219 | sIQGHNDyMCPATNQ | zf-C4 |
ABL1 | P00519 | human | RAPGEF1 | Q13905 | Y504 | APIPSVPyAPFAAIL | |
ABL1 | P00519 | human | PLK1 | P53350 | Y445 | DSTRLILyNDGDsLQ | POLO_box |
ABL1 | P00519 | human | CRK | P46108 | Y239 | NLQNGPIyARVIQKR | SH3_2 |
ABL1 | P00519 | human | ZAP70 | P43403 | Y319 | tsVyEsPysDPEELk | |
ABL1 | P00519 | human | JUNB | P17275 | Y182 | GPEPPPVyTNLSSyS | Jun |
ABL1 | P00519 | human | EGFR | P00533 | Y1092 | tFLPVPEyINQsVPk | |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | S600 | tPVRysssEVNHLsP | |
ABL1 | P00519 | human | ABI1 | Q8IZP0 | Y213 | PPtVPNDyMtsPARL | |
ABL1 | P00519 | human | MAVS | Q7Z434 | Y30 | DVVEILPyLPCLTAR | CARD_2 |
ABL1 | P00519 | human | PHF5A | Q7RTV0 | Y36 | kCVICDSyVRPCTLV | PHF5 |
ABL1 | P00519 | human | TP63 | Q9H3D4 | Y149 | SVTAPSPyAQPSSTF | |
ABL1 | P00519 | human | ABL1 | P00519-2 | Y412 | RLMTGDtyTAHAGAK | PK_Tyr_Ser-Thr |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | S697 | PGTsDsysAPRDCLT | |
ABL1 | P00519 | human | PXN | P49023 | Y31 | FLSEEtPysyPtGNH | |
ABL1 | P00519 | human | WASF3 | Q9UPY6 | Y151 | KKDGLKFyTDPSyFF | |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | Y665 | AQPADRGyDRPKAVs | |
ABL1 | P00519 | human | PDGFRB | P09619 | Y686 | IITEyCRyGDLVDyL | PK_Tyr_Ser-Thr |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | S598 | EEtPVRysssEVNHL | |
ABL1 | P00519 | human | CDC73 | Q6P1J9 | Y293 | IPAAyNRyDQERFkG | CDC73_N |
ABL1 | P00519 | human | CASP9 | P55211 | Y397 | AVSVkGIyKQMPGCF | Peptidase_C14 |
ABL1 | P00519 | human | PYCARD | Q9ULZ3 | Y146 | kVLTDEQyQAVRAEP | CARD |
ABL1 | P00519 | human | CD19 | P15391 | Y508 | EDMRGILyAAPQLRs | |
ABL1 | P00519 | human | CDKN1B | P46527 | Y88 | kGsLPEFyyRPPRPP | |
ABL1 | P00519 | human | CTNNB1 | P35222 | Y86 | VADIDGQyAMTRAQR | |
ABL1 | P00519 | human | FOXA1 | P55317 | Y429 | QALQYsPyGSTLPAS | HNF_C |
ABL1 | P00519 | human | MYLK | Q15746 | Y792 | QPWHAGQyEILLKNR | I-set |
ABL1 | P00519 | human | MYLK | Q15746 | Y464 | QEGsIEVyEDAGsHy | I-set |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | Y655 | GyADLDPyNsPGQEV | |
ABL1 | P00519 | human | JUNB | P17275 | Y173 | PAGPGGVyAGPEPPP | Jun |
ABL1 | P00519 | human | SNCA | P37840 | Y125 | VDPDNEAyEMPsEEG | Synuclein |
ABL1 | P00519 | human | NOX5 | Q96PH1 | Y478 | YRPGDyLyLNIPTIA | FAD_binding_8 |
ABL1 | P00519 | human | MYLK | Q15746 | Y231 | NQDDVGVyTCLVVNG | I-set |
ABL1 | P00519 | human | MYLK | Q15746 | Y846 | DGGGSDRyGsLRPGW | |
ABL1 | P00519 | human | PIK3AP1 | Q6ZUJ8 | Y594 | DRPQssIyDPFAGMk | |
ABL1 | P00519 | human | GPX1 | P07203 | Y98 | EILNSLkyVRPGGGF | GSHPx |
ABL1 | P00519 | human | SRCIN1 | Q9C0H9 | Y396 | LVKGEGLyADPyGLL | |
ABL1 | P00519 | human | NOS3 | P29474 | Y81 | WEVGSITyDTLSAQA | |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | S760 | PQStQEVsGAGRDGE | |
ABL1 | P00519 | human | MDM4 | O15151 | Y99 | VkDPsPLyDMLRKNL | |
ABL1 | P00519 | human | HIPK2 | Q9H2X6 | Y367 | tyLQsRYyRAPEIIL | Pkinase |
ABL1 | P00519 | human | TRIM33 | Q9UPN9 | Y1048 | MMKVVQVyADtQEIN | Bromodomain |
ABL1 | P00519 | human | TBX21 | Q9UL17 | Y220 | SMPGNRLyVHPDSPN | T-box |
ABL1 | P00519 | human | PSMA7 | O14818 | Y106 | EDPVTVEyItRyIAS | Proteasome |
ABL1 | P00519 | human | PPARG | P37231 | Y78 | SSISTPHyEDIPFTR | PPARgamma_N |
ABL1 | P00519 | human | ATR | Q13535 | Y291 | DTDQLKLyEEPLSkL | |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | Y649 | EEGKEAGyADLDPyN | |
ABL1 | P00519 | human | AHSA1 | O95433 | Y223 | LtsPEELyRVFTTQE | AHSA1 |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | Y589 | QRAGRHEyALPLAPP | |
ABL1 | P00519 | human | DNM1L | O00429 | Y266 | TDSIRDEyAFLQkkY | Dynamin_M |
ABL1 | P00519 | human | LGALS3 | P17931 | Y107 | AYPATGPyGAPAGPL | |
ABL1 | P00519 | human | LGALS3 | P17931 | Y79 | GAPAPGVyPGPPSGP | |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | Y600 | LAPPEPEyAtPIVER | |
ABL1 | P00519 | human | WASF3 | Q9UPY6 | Y486 | SRRIAVEySDSDDDS | |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | S556 | GTVTRKGsTFRPMDT | |
ABL1 | P00519 | human | ESR2 | Q92731 | Y36 | SIYIPSSyVDSHHEY | ERbeta_N |
ABL1 | P00519 | human | RAD51 | Q06609 | Y54 | HTVEAVAyAPkkELI | HHH_5 |
ABL1 | P00519 | human | EGFR | P00533 | Y1197 | stAENAEyLRVAPQS | |
ABL1 | P00519 | human | GLO1 | Q04760 | Y136 | GIAVPDVysACkRFE | Glyoxalase |
ABL1 | P00519 | human | STX17 | P56962 | Y157 | SQSLTQIyALPEIPQ | |
ABL1 | P00519 | human | PPARG | P37231 | Y102 | yDLKLQEyQSAIkVE | PPARgamma_N |
ABL1 | P00519 | human | GMNN | O75496 | Y150 | EVAEHVQyMAELIER | Geminin |
ABL1 | P00519 | human | SNCA | P37840 | Y39 | kTkEGVLyVGsKTkE | Synuclein |
ABL1 | P00519 | human | NFKBIA | P25963 | Y305 | FtEDELPyDDCVFGG | |
ABL1 | P00519 | human | MUC1 | P15941 | Y1243 | NGGSsLsytNPAVAA | |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | S693 | PPTHPGTsDsysAPR | |
ABL1 | P00519 | human | SORBS2 | O94875-2 | Y573 | NTKGAEDyPDPPIPH | |
ABL1 | P00519 | human | ERRFI1 | Q9UJM3 | Y394 | KKVsstHyyLLPERP | |
ABL1 | P00519 | human | CAV1 | Q03135 | Y14 | VDsEGHLytVPIREQ | |
ABL1 | P00519 | human | RAD51 | Q06609 | Y315 | EtRICKIyDSPCLPE | Rad51 |
ABL1 | P00519 | human | FOXA1 | P55317 | Y464 | PAYYQGVySRPVLNT | |
ABL1 | P00519 | human | RTCB | Q9Y3I0 | Y316 | GMAAAGNyAWVNRSS | RtcB |
ABL1 | P00519 | human | ESR1 | P03372 | Y52 | DssKPAVyNYPEGAA | Oest_recep |
ABL1 | P00519 | human | ATR | Q13535 | Y310 | FPFEAEAyRNIEPVY | |
ABL1 | P00519 | human | BCR | P11274 | Y177 | ADAEKPFyVNVEFHH | |
ABL1 | P00519 | human | PLCG1 | P19174 | Y1003 | KGKKFLQyNRLQLSR | PI-PLC-Y |
ABL1 | P00519 | human | MET | P08581 | Y1356 | yVHVNAtyVNVKCVA | |
ABL1 | P00519 | human | BTK | Q06187 | Y223 | LKKVVALyDyMPMNA | SH3_1 |
ABL1 | P00519 | human | EGFR | P00533 | Y1016 | DVVDADEyLIPQQGF | |
ABL1 | P00519 | human | RACK1 | P63244 | Y52 | LtrDEtNyGIPQRAL | |
ABL1 | P00519 | human | SORBS2 | O94875-2 | Y175 | YTYNAGLyNPPYSAQ | |
ABL1 | P00519 | human | ABL2 | P42684 | Y261 | GLVTTLHyPAPKCNK | |
ABL1 | P00519 | human | STK3 | Q13188 | Y81 | MQQCDSPyVVKYYGS | Pkinase |
ABL1 | P00519 | human | PLCG1 | P19174 | Y771 | IGtAEPdyGALyEGR | |
ABL1 | P00519 | human | PLK1 | P53350 | Y217 | tLCGtPNyIAPEVLs | Pkinase |
ABL1 | P00519 | human | SNW1 | Q13573 | Y292 | AKLAEALyIADRKAR | SKIP_SNW |
ABL1 | P00519 | human | PIK3AP1 | Q6ZUJ8 | Y570 | QERPGNFyVSSEsIR | |
ABL1 | P00519 | human | CEBPB | P17676 | Y78 | RAIDFsPyLEPLGAP | |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | Y540 | ITsDMADyQQPLMIG | |
ABL1 | P00519 | human | OTULIN | Q96BN8 | Y56 | AEHEEDMyRAADEIE | |
ABL1 | P00519 | human | JUN | P05412 | Y170 | LHSEPPVyANLSNFN | Jun |
ABL1 | P00519 | human | IRF3 | Q14653 | Y292 | rLGHCHTyWAVSEEL | IRF-3 |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | Y597 | HEEtPVRysssEVNH | |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | Y621 | LQADsAEyAQPLVGG | |
ABL1 | P00519 | human | CTTN | Q14247 | Y486 | yPAEDStyDEYENDL | |
ABL1 | P00519 | human | TP63 | Q9H3D4 | Y171 | AIPSNTDyPGPHSFD | P53 |
ABL1 | P00519 | human | NCOA3 | Q9Y6Q9 | Y1357 | HPQAASIyQSSEMKG | |
ABL1 | P00519 | human | RBM39 | Q14498 | Y95 | DRRFRGRyrsPysGP | |
ABL1 | P00519 | human | SNW1 | Q13573 | Y433 | EDEIyNVyDQAWrGG | |
ABL1 | P00519 | human | EMD | P50402 | Y167 | AyQsItHyRPVsAsR | |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | T679 | ITGPEyAtPIIMDMS | |
ABL1 | P00519 | human | NCK1 | P16333 | Y105 | VDPGERLyDLNMPAy | |
ABL1 | P00519 | human | PIK3AP1 | Q6ZUJ8 | Y694 | AKVEFGVyEsGPRKs | |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | Y677 | LPITGPEyAtPIIMD | |
ABL1 | P00519 | human | CAT | P04040 | Y386 | yRARVANyQRDGPMC | Catalase |
ABL1 | P00519 | human | RAD52 | P43351 | Y104 | DLNNGKFyVGVCAFV | Rad52_Rad22 |
ABL1 | P00519 | human | ROBO1 | Q9Y6N7 | Y1114 | QEVAPVQyNIVEQNk | |
ABL1 | P00519 | human | YAP1 | P46937-3 | Y357 | SGLSMSSySVPRtPD | |
ABL1 | P00519 | human | WASF3 | Q9UPY6 | Y337 | LPAQIIEyYNPSGPP | |
ABL1 | P00519 | human | DDX5 | P17844 | Y593 | NGMNQQAyAyPATAA | |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | S513 | yPFARHQsAEFtISY | |
ABL1 | P00519 | human | PLK1 | P53350 | Y425 | SDkYGLGyQLCDNSV | POLO_box |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | S618 | TTVLQADsAEyAQPL | |
ABL1 | P00519 | human | CDC73 | Q6P1J9 | Y290 | kQPIPAAyNRyDQER | CDC73_N |
ABL1 | P00519 | human | ARHGDIB | P52566 | Y24 | ELdskLNykPPPQks | Rho_GDI |
ABL1 | P00519 | human | TBX21 | Q9UL17 | Y266 | VLQsLHKyQPRLHIV | T-box |
ABL1 | P00519 | human | MYLK | Q15746 | Y1635 | VAPEVINyEPIGYAT | Pkinase |
ABL1 | P00519 | human | JUNB | P17275 | Y188 | VyTNLSSySPASASS | Jun |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | Y666 | GQEVyHAyAEPLPIT | |
ABL1 | P00519 | human | PIK3AP1 | Q6ZUJ8 | Y553 | QLPDNEPyIFKVFAE | |
ABL1 | P00519 | human | GMFG | O60234 | Y104 | kPEQQMMyAGSkNRL | Cofilin_ADF |
ABL1 | P00519 | human | SRCIN1 | Q9C0H9 | Y264 | IYRKEPLyAAFPGSH | AIP3 |
ABL1 | P00519 | human | PSMA7 | O14818 | Y153 | QTDPsGtyHAWkANA | Proteasome |
ABL1 | P00519 | human | TRIM33 | Q9UPN9 | Y524 | QHMQQQVyAQKHQQL | |
ABL1 | P00519 | human | CDKN1B | P46527 | Y89 | GsLPEFyyRPPRPPK | |
ABL1 | P00519 | human | NUMA1 | Q14980 | Y1774 | VEsLEsLyFtPIPAR | |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | Y578 | STDAGGHyDCPQRAG | |
ABL1 | P00519 | human | CRK | P46108 | Y251 | QKRVPNAyDktALAL | SH3_2 |
ABL1 | P00519 | human | DNM1L | O00429 | Y368 | CGGARICyIFHETFG | Dynamin_M |
ABL1 | P00519 | human | ZNF746 | Q6NUN9 | Y137 | ETLVSLDyAISKPEV | |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | T593 | kAVDHEEtPVRysss | |
ABL1 | P00519 | human | TUBG1 | P23258 | Y443 | HAATRPDyISWGTQE | |
ABL1 | P00519 | human | PLEKHG2 | Q9H7P9 | Y489 | sEPVKDPyVMFPQNA | |
ABL1 | P00519 | human | DDB1 | Q16531 | Y182 | APTICFVyQDPQGRH | MMS1_N |
ABL1 | P00519 | human | SORBS2 | O94875-2 | Y50 | AVSPMSYyQRPFSPS | |
ABL1 | P00519 | human | LGALS3 | P17931 | Y118 | AGPLIVPyNLPLPGG | Gal-bind_lectin |
ABL1 | P00519 | human | PRAG1 | Q86YV5 | Y413 | ATQPEPIyAEsTKRK | |
ABL1 | P00519 | human | MYLK | Q15746 | Y611 | KSSRkSEyLLPVAPS | |
ABL1 | P00519 | human | CTNNB1 | P35222 | Y489 | QNAVRLHyGLPVVVk | |
ABL1 | P00519 | human | CTNNB1 | P35222 | Y654 | RNEGVAtyAAAVLFR | |
ABL1 | P00519 | human | SORBS2 | O94875-2 | Y164 | PDDDTDMyNTPYTYN | |
ABL1 | P00519 | human | DNM1L | O00429 | Y449 | IIQHCSNySTQELLR | Dynamin_M |
ABL1 | P00519 | human | PLSCR1 | O15162 | Y74 | PVyNQPVyNQPVGAA | |
ABL1 | P00519 | human | ERCC6 | Q03468 | Y932 | GANRVVIyDPDWNPS | Helicase_C |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | T714 | QPPPLVGtyNtLLsR | |
ABL1 | P00519 | human | PRKN | O60260 | Y143 | sPAGRSIyNSFYVYC | |
ABL1 | P00519 | human | MYLK | Q15746 | Y556 | LNGQPIQyARSTCEA | I-set |
ABL1 | P00519 | human | SNW1 | Q13573 | Y430 | AGGEDEIyNVyDQAW | |
ABL1 | P00519 | human | FHL2 | Q14192 | Y97 | TDCySNEySSkCQEC | LIM |
ABL1 | P00519 | human | RAD9A | Q99638 | Y28 | SRIGDELyLEPLEDG | Rad9 |
ABL1 | P00519 | human | SPTLC1 | O15269 | Y164 | KTEEAIIySYGFATI | Aminotran_1_2 |
ABL1 | P00519 | human | MAVS | Q7Z434 | Y71 | RRPGWVEyFIAALRG | CARD_2 |
ABL1 | P00519 | human | CHCHD2 | Q9Y6H1 | Y99 | PARPDITyQEPQGTQ | |
ABL1 | P00519 | human | STK4 | Q13043 | Y433 | kIPQDGDyEFLksWt | Mst1_SARAH |
ABL1 | P00519 | human | PDGFRB | P09619 | Y934 | AHAsDEIyEIMQKCW | PK_Tyr_Ser-Thr |
ABL1 | P00519 | human | RBM39 | Q14498 | Y99 | RGRyrsPysGPkFNs | |
ABL1 | P00519 | human | NFAT5 | O94916 | Y143 | PkRHtVLyIsPPPED | |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | Y663 | NsPGQEVyHAyAEPL | |
ABL1 | P00519 | human | ERRFI1 | Q9UJM3 | Y395 | KVsstHyyLLPERPP | |
ABL1 | P00519 | human | TRIM33 | Q9UPN9 | Y610 | PrHSGPQySMMQPHL | |
ABL1 | P00519 | human | WASF3 | Q9UPY6 | Y248 | HASDVtDySYPATPN | |
ABL1 | P00519 | human | HDAC2 | Q92769 | Y222 | IGAGkGkyYAVNFPM | Hist_deacetyl |
ABL1 | P00519 | human | FHL2 | Q14192 | Y236 | SGLGGTkyIsFEERQ | LIM |
ABL1 | P00519 | human | ROBO1 | Q9Y6N7 | Y1073 | PSGQPTPyAtTQLIQ | |
ABL1 | P00519 | human | MYLK | Q15746 | Y1575 | QISEGVEyIHKQGIV | Pkinase |
ABL1 | P00519 | human | PDHA1 | P08559 | Y301 | MsDPGVsyRtREEIQ | E1_dh |
ABL1 | P00519 | human | MDM2 | Q00987 | Y276 | sDEDDEVyQVtVyQA | |
ABL1 | P00519 | human | RTCB | Q9Y3I0 | Y306 | AsPEGQDyLkGMAAA | RtcB |
ABL1 | P00519 | human | PDK1 | Q15118 | Y243 | ARRLCDLyyINSPEL | |
ABL1 | P00519 | human | FUS | P35637 | Y526 | QDrrErPy_______ | |
ABL1 | P00519 | human | FHL2 | Q14192 | Y217 | LNCFCDLyAKkCAGC | LIM |
ABL1 | P00519 | human | DCBLD2 | Q96PD2 | S599 | EtPVRysssEVNHLs | |
ABL1 | P00519 | human | MDM2 | Q00987 | Y405 | STSSSIIyssQEDVK | |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | Y621 | tFsAQsGyRVPGPQP | |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | Y696 | HPGTsDsysAPRDCL | |
ABL1 | P00519 | human | LASP1 | Q14847 | Y171 | IPtsAPVyQQPQQQP | |
ABL1 | P00519 | human | PRKD1 | Q15139 | Y463 | NDTGsRYyKEIPLSE | PH |
ABL1 | P00519 | human | YY1 | P25490 | Y254 | sPPDySEyMTGkKLP | |
ABL1 | P00519 | human | ARHGDIB | P52566 | Y130 | LkYVQHtyRTGVkVD | Rho_GDI |
ABL1 | P00519 | human | DDB1 | Q16531 | Y718 | HIRtVPLyEsPRkIC | |
ABL1 | P00519 | human | WAS | P42768 | Y291 | AEtsKLIyDFIEDQG | PBD |
ABL1 | P00519 | human | CKMT1B | P12532 | Y153 | AsKIRsGyFDErYVL | |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | S535 | QkLDLITsDMADyQQ | |
ABL1 | P00519 | human | KAT5 | Q92993 | Y44 | ISGRKLFyVHYIDFN | Tudor-knot |
ABL1 | P00519 | human | MAVS | Q7Z434 | Y9 | PFAEDkTykyICRNF | CARD_2 |
ABL1 | P00519 | human | RTCB | Q9Y3I0 | Y475 | MEEAPESykNVTDVV | RtcB |
ABL1 | P00519 | human | DCBLD1 | Q8N8Z6 | Y652 | VGAQDGDyQRPHsAQ | |
ABL1 | P00519 | human | TOP1 | P11387 | Y268 | AkMLDHEyTTkEIFR | Topoisom_I_N |
ABL1 | P00519 | human | SMAD4 | Q13485 | Y322 | SNHPAPEyWCSIAYF | |
ABL1 | P00519 | human | VAV1 | P15498 | Y267 | TPGAANLyQVFIKYK | RhoGEF |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
ABL1 | ID | Description | 0.00e+00 |
ABL1 | GO:0097193 | intrinsic apoptotic signaling pathway | 2.05e-15 |
ABL1 | GO:0062197 | cellular response to chemical stress | 1.46e-14 |
ABL1 | GO:0034599 | cellular response to oxidative stress | 9.05e-12 |
ABL1 | GO:2001233 | regulation of apoptotic signaling pathway | 1.04e-10 |
ABL1 | GO:0006979 | response to oxidative stress | 1.04e-10 |
ABL1 | GO:0030522 | intracellular receptor signaling pathway | 1.04e-10 |
ABL1 | GO:0050673 | epithelial cell proliferation | 2.35e-10 |
ABL1 | GO:0000302 | response to reactive oxygen species | 4.09e-10 |
ABL1 | GO:0072331 | signal transduction by p53 class mediator | 6.46e-10 |
ABL1 | GO:0032355 | response to estradiol | 8.39e-10 |
ABL1 | GO:0042770 | signal transduction in response to DNA damage | 1.51e-09 |
ABL1 | GO:0032970 | regulation of actin filament-based process | 1.94e-09 |
ABL1 | GO:1902903 | regulation of supramolecular fiber organization | 2.61e-09 |
ABL1 | GO:0032956 | regulation of actin cytoskeleton organization | 2.61e-09 |
ABL1 | GO:0050678 | regulation of epithelial cell proliferation | 5.06e-09 |
ABL1 | GO:0002757 | immune response-activating signaling pathway | 6.54e-09 |
ABL1 | GO:0051098 | regulation of binding | 6.54e-09 |
ABL1 | GO:0072332 | intrinsic apoptotic signaling pathway by p53 class mediator | 1.06e-08 |
ABL1 | GO:0002764 | immune response-regulating signaling pathway | 1.42e-08 |
ABL1 | GO:0034614 | cellular response to reactive oxygen species | 1.67e-08 |
ABL1 | GO:0031334 | positive regulation of protein-containing complex assembly | 2.17e-08 |
ABL1 | GO:0061614 | miRNA transcription | 4.65e-08 |
ABL1 | GO:0008630 | intrinsic apoptotic signaling pathway in response to DNA damage | 5.89e-08 |
ABL1 | GO:1902905 | positive regulation of supramolecular fiber organization | 6.15e-08 |
ABL1 | GO:0010212 | response to ionizing radiation | 6.56e-08 |
ABL1 | GO:0010586 | miRNA metabolic process | 6.96e-08 |
ABL1 | GO:0031400 | negative regulation of protein modification process | 7.69e-08 |
ABL1 | GO:0048144 | fibroblast proliferation | 7.79e-08 |
ABL1 | GO:2001242 | regulation of intrinsic apoptotic signaling pathway | 1.31e-07 |
ABL1 | GO:0051090 | regulation of DNA-binding transcription factor activity | 1.86e-07 |
ABL1 | GO:2000628 | regulation of miRNA metabolic process | 1.86e-07 |
ABL1 | GO:0010517 | regulation of phospholipase activity | 1.86e-07 |
ABL1 | GO:0048145 | regulation of fibroblast proliferation | 2.43e-07 |
ABL1 | GO:0001933 | negative regulation of protein phosphorylation | 2.59e-07 |
ABL1 | GO:0043254 | regulation of protein-containing complex assembly | 2.59e-07 |
ABL1 | GO:0051099 | positive regulation of binding | 3.27e-07 |
ABL1 | GO:0009314 | response to radiation | 3.32e-07 |
ABL1 | GO:0045936 | negative regulation of phosphate metabolic process | 4.34e-07 |
ABL1 | GO:0010563 | negative regulation of phosphorus metabolic process | 4.38e-07 |
ABL1 | GO:0048732 | gland development | 5.01e-07 |
ABL1 | GO:0042326 | negative regulation of phosphorylation | 5.46e-07 |
ABL1 | GO:0098781 | ncRNA transcription | 5.46e-07 |
ABL1 | GO:1902893 | regulation of miRNA transcription | 5.58e-07 |
ABL1 | GO:0030330 | DNA damage respons | 1.01e-08 |
ABL1 | GO:2001235 | positive regulation of apoptotic signaling pathway | 9.26e-07 |
ABL1 | GO:0033673 | negative regulation of kinase activity | 1.19e-06 |
ABL1 | GO:0060191 | regulation of lipase activity | 1.19e-06 |
ABL1 | GO:0010332 | response to gamma radiation | 1.20e-06 |
ABL1 | GO:0051091 | positive regulation of DNA-binding transcription factor activity | 1.28e-06 |
Top |
Related Drugs to EML1_ABL1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning EML1-ABL1 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
EML1-ABL1 AND Imatinib | NUP214-ABL1 AND Imatinib | 19166098 | 2005-10 | 10.1016/j.cancergencyto.2005.04.002 | ABL1 fusions in T-cell acute lymphoblastic leukemia. |
EML1-ABL1 AND Crizotinib | EML4-ALK AND Crizotinib | 25874286 | 2022-03-17 | 10.1002/9781119671404.ch6 | "In vivo ""editing'' of cellular genome: one more step toward animals models mimicking tumorigenesis" |
Top |
Related Diseases to EML1_ABL1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | EML1 | C4284594 | BAND HETEROTOPIA | 2 | GENOMICS_ENGLAND;UNIPROT |
Tgene | ABL1 | C0023473 | Myeloid Leukemia, Chronic | 3 | CGI;CTD_human;ORPHANET |
Tgene | ABL1 | C0023452 | Childhood Acute Lymphoblastic Leukemia | 2 | CTD_human |
Tgene | ABL1 | C0023453 | L2 Acute Lymphoblastic Leukemia | 2 | CTD_human |
Tgene | ABL1 | C1961102 | Precursor Cell Lymphoblastic Leukemia Lymphoma | 2 | CGI;CTD_human |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |