UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:ETV6_ABL2 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: ETV6_ABL2 | KinaseFusionDB ID: KFG2173 | FusionGDB2.0 ID: KFG2173 | Hgene | Tgene | Gene symbol | ETV6 | ABL2 | Gene ID | 2120 | 27 | |
Gene name | ETS variant transcription factor 6 | ABL proto-oncogene 2, non-receptor tyrosine kinase | ||||||||||
Synonyms | TEL|TEL/ABL|THC5 | ABLL|ARG | ||||||||||
Cytomap | 12p13.2 | 1q25.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | transcription factor ETV6ETS-related protein Tel1ETV6-RUNX1 fusion proteinTEL1 oncogeneets variant gene 6 (TEL oncogene) | tyrosine-protein kinase ABL2Abelson tyrosine-protein kinase 2abelson-related gene proteinc-abl oncogene 2, non-receptor tyrosine kinasetyrosine-protein kinase ARGv-abl Abelson murine leukemia viral oncogene homolog 2 | ||||||||||
Modification date | 20240305 | 20240411 | ||||||||||
UniProtAcc | P41212 | P42684 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000396373, ENST00000544715, | ENST00000344730, ENST00000367623, ENST00000392043, ENST00000408940, ENST00000504405, ENST00000507173, ENST00000511413, ENST00000512653, ENST00000502732, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: ETV6 [Title/Abstract] AND ABL2 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ETV6 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 10514502 |
Tgene | ABL2 | GO:0018108 | peptidyl-tyrosine phosphorylation | 15886098 |
Tgene | ABL2 | GO:0051353 | positive regulation of oxidoreductase activity | 12893824 |
Kinase Fusion gene breakpoints across ETV6 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across ABL2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerKB3 | . | ETV6 | chr12 | 12022903 | ABL2 | chr1 | 179102509 |
ChimerKB4 | . | ETV6 | chr12 | 12022903 | ABL2 | chr1 | 179102509 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000396373 | ENST00000502732 | ETV6 | chr12 | 12022903 | ABL2 | chr1 | 179102509 | 13066 | 1466 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000396373_ENST00000502732_ETV6_chr12_12022903_ABL2_chr1_179102509_length(amino acids)=1466 MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMN GKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMP SPIMHPLILNPRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADHFASCVEDGFEGDKTGGSSPEAL HRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVN SLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLV TTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ LLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTG DTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSP ADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQA SSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPA QQEANLVPPKCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDR MAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAA APKGKEKNGGARLGMAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPR RVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTK VALRKTKQAAEKISADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAA -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr12:/chr1:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
ETV6 | ABL2 |
FUNCTION: Transcriptional repressor; binds to the DNA sequence 5'-CCGGAAGT-3'. Plays a role in hematopoiesis and malignant transformation. {ECO:0000269|PubMed:25581430}. | FUNCTION: Non-receptor tyrosine-protein kinase that plays an ABL1-overlapping role in key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion and receptor endocytosis. Coordinates actin remodeling through tyrosine phosphorylation of proteins controlling cytoskeleton dynamics like MYH10 (involved in movement); CTTN (involved in signaling); or TUBA1 and TUBB (microtubule subunits). Binds directly F-actin and regulates actin cytoskeletal structure through its F-actin-bundling activity. Involved in the regulation of cell adhesion and motility through phosphorylation of key regulators of these processes such as CRK, CRKL, DOK1 or ARHGAP35. Adhesion-dependent phosphorylation of ARHGAP35 promotes its association with RASA1, resulting in recruitment of ARHGAP35 to the cell periphery where it inhibits RHO. Phosphorylates multiple receptor tyrosine kinases like PDGFRB and other substrates which are involved in endocytosis regulation such as RIN1. In brain, may regulate neurotransmission by phosphorylating proteins at the synapse. ABL2 acts also as a regulator of multiple pathological signaling cascades during infection. Pathogens can highjack ABL2 kinase signaling to reorganize the host actin cytoskeleton for multiple purposes, like facilitating intracellular movement and host cell exit. Finally, functions as its own regulator through autocatalytic activity as well as through phosphorylation of its inhibitor, ABI1. Positively regulates chemokine-mediated T-cell migration, polarization, and homing to lymph nodes and immune-challenged tissues, potentially via activation of NEDD9/HEF1 and RAP1 (By similarity). {ECO:0000250|UniProtKB:Q4JIM5, ECO:0000269|PubMed:15735735, ECO:0000269|PubMed:15886098, ECO:0000269|PubMed:16678104, ECO:0000269|PubMed:17306540, ECO:0000269|PubMed:18945674}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 10 | 288_539 | 0 | 543 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 11 | 288_539 | 0 | 1147 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 11 | 288_539 | 0 | 1162 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 12 | 288_539 | 0 | 1044 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 12 | 288_539 | 0 | 1059 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 12 | 288_539 | 37 | 1168 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 12 | 288_539 | 52 | 1183 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 13 | 288_539 | 37 | 1065 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 13 | 288_539 | 52 | 1080 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 10 | 173_263 | 0 | 543 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 11 | 173_263 | 0 | 1147 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 11 | 173_263 | 0 | 1162 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 12 | 173_263 | 0 | 1044 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 12 | 173_263 | 0 | 1059 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 12 | 173_263 | 37 | 1168 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 12 | 173_263 | 52 | 1183 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 13 | 173_263 | 37 | 1065 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 13 | 173_263 | 52 | 1080 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 10 | 107_167 | 0 | 543 | Domain | Note=SH3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00192 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 11 | 107_167 | 0 | 1147 | Domain | Note=SH3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00192 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 11 | 107_167 | 0 | 1162 | Domain | Note=SH3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00192 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 12 | 107_167 | 0 | 1044 | Domain | Note=SH3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00192 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 12 | 107_167 | 0 | 1059 | Domain | Note=SH3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00192 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 12 | 107_167 | 37 | 1168 | Domain | Note=SH3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00192 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 12 | 107_167 | 52 | 1183 | Domain | Note=SH3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00192 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 13 | 107_167 | 37 | 1065 | Domain | Note=SH3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00192 |
Tgene | ETV6 | 12022903 | ABL2 | 179102509 | ENST00000396373 | 0 | 13 | 107_167 | 52 | 1080 | Domain | Note=SH3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00192 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>176_ETV6_ABL2 | ENST00000396373 | ENST00000502732 | ETV6 | chr12 | 12022903 | ABL2 | chr1 | 179102509 | MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMN GKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMP SPIMHPLILNPRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADHFASCVEDGFEGDKTGGSSPEAL HRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVN SLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLV TTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ LLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTG DTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSP ADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQA SSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPA QQEANLVPPKCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDR MAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAA APKGKEKNGGARLGMAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPR RVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTK VALRKTKQAAEKISADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAA | 1466 |
3D view using mol* of 176_ETV6_ABL2 | ||||||||||
PDB file >>>TKFP_313_ETV6_ABL2 | ENST00000396373 | ENST00000502732 | ETV6 | chr12 | 12022903 | ABL2 | chr1 | 179102509 | MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMN GKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMP SPIMHPLILNPRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADHFASCVEDGFEGDKTGGSSPEAL HRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVN SLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLV TTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ LLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTG DTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSP ADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQA SSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPA QQEANLVPPKCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDR MAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAA APKGKEKNGGARLGMAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPR RVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTK VALRKTKQAAEKISADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAA | 1466_ETV6_ABL2 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
176_ETV6_ABL2.png |
176_ETV6_ABL2.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
176_ETV6_ABL2_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Larotrectinib | -8.374410000000001 | -8.374410000000001 | -47.9165 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Lapatinib | -7.4858899999999995 | -7.5746899999999995 | -63.5579 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Nilotinib | -7.34479 | -8.269589999999999 | -51.0727 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Nilotinib | -7.34479 | -8.269589999999999 | -51.0727 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Pazopanib | -7.197589999999999 | -7.20449 | -49.8288 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Pazopanib | -7.197589999999999 | -7.20449 | -49.8288 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Gefitinib | -7.12568 | -7.54068 | -41.8216 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Gefitinib | -7.12568 | -7.54068 | -41.8216 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Tucatinib | -6.954460000000001 | -7.3296600000000005 | -51.5894 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Imatinib | -6.87064 | -7.07724 | -44.6977 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Imatinib | -6.87064 | -7.07724 | -44.6977 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Imatinib | -6.87064 | -7.07724 | -44.6977 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Acalabrutinib | -6.7388 | -6.7529 | -54.5237 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Acalabrutinib | -6.7388 | -6.7529 | -54.5237 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Dacomitinib | -6.71161 | -8.461210000000001 | -47.0167 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Dacomitinib | -6.71161 | -8.461210000000001 | -47.0167 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Dacomitinib | -6.71081 | -8.461210000000001 | -47.0167 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Avapritinib | -6.48682 | -6.8181199999999995 | -44.9969 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Avapritinib | -6.48682 | -6.8181199999999995 | -44.9969 |
176_ETV6_ABL2-DOCK_HTVS_1-001 | Avapritinib | -6.48682 | -6.8181199999999995 | -44.9969 |
Top |
Kinase-Substrate Information of ETV6_ABL2 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
ABL2 | P42684 | human | CAT | P04040 | Y231 | NANGEAVyCkFHYkT | Catalase |
ABL2 | P42684 | human | HRAS | P01112 | Y137 | AQDLARSyGIPYIEt | Ras |
ABL2 | P42684 | human | CRK | P46108 | Y221 | GGPEPGPyAQPsVNt | |
ABL2 | P42684 | human | MAPT | P10636-8 | Y310 | GGsVQIVykPVDLsk | Tubulin-binding |
ABL2 | P42684 | human | ABL2 | P42684 | Y439 | RLMtGDtytAHAGAk | PK_Tyr_Ser-Thr |
ABL2 | P42684 | human | PDGFRB | P09619 | Y686 | IITEyCRyGDLVDyL | PK_Tyr_Ser-Thr |
ABL2 | P42684 | human | GPX1 | P07203 | Y98 | EILNSLkyVRPGGGF | GSHPx |
ABL2 | P42684 | human | MICAL2 | O94851 | Y463 | INkNFEQyTLDPGTR | |
ABL2 | P42684 | human | LGALS3 | P17931 | Y79 | GAPAPGVyPGPPSGP | |
ABL2 | P42684 | human | MICAL2 | O94851 | Y488 | PHQVKHLyITKELEH | |
ABL2 | P42684 | human | ABL2 | P42684 | Y261 | GLVTTLHyPAPKCNK | |
ABL2 | P42684 | human | CEBPB | P17676 | Y78 | RAIDFsPyLEPLGAP | |
ABL2 | P42684 | human | IRF3 | Q14653 | Y292 | rLGHCHTyWAVSEEL | IRF-3 |
ABL2 | P42684 | human | CAT | P04040 | Y386 | yRARVANyQRDGPMC | Catalase |
ABL2 | P42684 | human | PSMA7 | O14818 | Y153 | QTDPsGtyHAWkANA | Proteasome |
ABL2 | P42684 | human | LGALS3 | P17931 | Y118 | AGPLIVPyNLPLPGG | Gal-bind_lectin |
ABL2 | P42684 | human | MAPT | P10636-8 | Y394 | DHGAEIVyKsPVVsG | |
ABL2 | P42684 | human | WWTR1 | Q9GZV5 | Y321 | sGLGLGCySVPTtPE | |
ABL2 | P42684 | human | MAPT | P10636-8 | Y197 | KsGDRsGyssPGsPG | |
ABL2 | P42684 | human | ITGB1 | P05556 | Y783 | DtGENPIyksAVttV | Integrin_b_cyt |
ABL2 | P42684 | human | SIVA1 | O15304 | Y34 | RGVCAERySQEVFEk | Siva |
ABL2 | P42684 | human | MICAL2 | O94851 | Y445 | LAERESLyRLLPQTT |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
ABL2 | ID | Description | 0.00e+00 |
ABL2 | GO:0010863 | positive regulation of phospholipase C activity | 1.90e-03 |
ABL2 | GO:1900274 | regulation of phospholipase C activity | 1.90e-03 |
ABL2 | GO:0010518 | positive regulation of phospholipase activity | 2.54e-03 |
ABL2 | GO:0010517 | regulation of phospholipase activity | 2.82e-03 |
ABL2 | GO:0060193 | positive regulation of lipase activity | 2.82e-03 |
ABL2 | GO:0000302 | response to reactive oxygen species | 2.92e-03 |
ABL2 | GO:1903829 | positive regulation of protein localization | 3.11e-03 |
ABL2 | GO:0043086 | negative regulation of catalytic activity | 3.11e-03 |
ABL2 | GO:0072593 | reactive oxygen species metabolic process | 3.11e-03 |
ABL2 | GO:0060191 | regulation of lipase activity | 3.11e-03 |
ABL2 | GO:0009650 | UV protection | 3.67e-03 |
ABL2 | GO:0090280 | positive regulation of calcium ion import | 5.18e-03 |
ABL2 | GO:0042542 | response to hydrogen peroxide | 5.18e-03 |
ABL2 | GO:1905477 | positive regulation of protein localization to membrane | 5.24e-03 |
ABL2 | GO:0032956 | regulation of actin cytoskeleton organization | 6.73e-03 |
ABL2 | GO:0071675 | regulation of mononuclear cell migration | 6.73e-03 |
ABL2 | GO:0007265 | Ras protein signal transduction | 6.73e-03 |
ABL2 | GO:0010288 | response to lead ion | 6.73e-03 |
ABL2 | GO:0035024 | negative regulation of Rho protein signal transduction | 6.73e-03 |
ABL2 | GO:1902473 | regulation of protein localization to synapse | 7.03e-03 |
ABL2 | GO:0061041 | regulation of wound healing | 7.26e-03 |
ABL2 | GO:1904375 | regulation of protein localization to cell periphery | 7.56e-03 |
ABL2 | GO:0032970 | regulation of actin filament-based process | 7.89e-03 |
ABL2 | GO:0033598 | mammary gland epithelial cell proliferation | 7.89e-03 |
ABL2 | GO:0090218 | positive regulation of lipid kinase activity | 7.89e-03 |
ABL2 | GO:0050900 | leukocyte migration | 8.69e-03 |
ABL2 | GO:0006979 | response to oxidative stress | 8.70e-03 |
ABL2 | GO:0030010 | establishment of cell polarity | 8.72e-03 |
ABL2 | GO:0007159 | leukocyte cell-cell adhesion | 9.38e-03 |
ABL2 | GO:0042744 | hydrogen peroxide catabolic process | 9.38e-03 |
ABL2 | GO:0042060 | wound healing | 9.38e-03 |
ABL2 | GO:0009314 | response to radiation | 9.40e-03 |
ABL2 | GO:0090279 | regulation of calcium ion import | 9.40e-03 |
ABL2 | GO:0051897 | positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction | 9.40e-03 |
ABL2 | GO:1903034 | regulation of response to wounding | 9.45e-03 |
ABL2 | GO:1905475 | regulation of protein localization to membrane | 1.05e-02 |
ABL2 | GO:0046578 | regulation of Ras protein signal transduction | 1.05e-02 |
ABL2 | GO:0006935 | chemotaxis | 1.11e-02 |
ABL2 | GO:0042330 | taxis | 1.11e-02 |
ABL2 | GO:0043550 | regulation of lipid kinase activity | 1.12e-02 |
ABL2 | GO:0055001 | muscle cell development | 1.15e-02 |
ABL2 | GO:0007264 | small GTPase mediated signal transduction | 1.22e-02 |
ABL2 | GO:0050777 | negative regulation of immune response | 1.26e-02 |
ABL2 | GO:0071674 | mononuclear cell migration | 1.27e-02 |
ABL2 | GO:1990090 | cellular response to nerve growth factor stimulus | 1.34e-02 |
ABL2 | GO:0051346 | negative regulation of hydrolase activity | 1.34e-02 |
ABL2 | GO:0043666 | regulation of phosphoprotein phosphatase activity | 1.34e-02 |
ABL2 | GO:0046580 | negative regulation of Ras protein signal transduction | 1.34e-02 |
ABL2 | GO:0070509 | calcium ion import | 1.34e-02 |
Top |
Related Drugs to ETV6_ABL2 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning ETV6-ABL2 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to ETV6_ABL2 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
ETV6 | ABL2 | Breast Invasive Ductal Carcinoma | MyCancerGenome | |
ETV6 | ABL2 | Invasive Breast Carcinoma | MyCancerGenome | |
ETV6 | ABL2 | Lung Adenocarcinoma | MyCancerGenome | |
ETV6 | ABL2 | Appendix Adenocarcinoma | MyCancerGenome | |
ETV6 | ABL2 | Colon Adenocarcinoma | MyCancerGenome |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | ETV6 | C4015537 | THROMBOCYTOPENIA 5 | 4 | CTD_human;GENOMICS_ENGLAND;UNIPROT |
Hgene | ETV6 | C0023485 | Precursor B-Cell Lymphoblastic Leukemia-Lymphoma | 3 | CTD_human |
Hgene | ETV6 | C0040034 | Thrombocytopenia | 3 | CTD_human;GENOMICS_ENGLAND |
Hgene | ETV6 | C0023480 | Leukemia, Myelomonocytic, Chronic | 2 | ORPHANET |
Hgene | ETV6 | C1332965 | Congenital Mesoblastic Nephroma | 2 | ORPHANET |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |