UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:ETV6_SYK |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: ETV6_SYK | KinaseFusionDB ID: KFG2184 | FusionGDB2.0 ID: KFG2184 | Hgene | Tgene | Gene symbol | ETV6 | SYK | Gene ID | 2120 | 6850 | |
Gene name | ETS variant transcription factor 6 | spleen associated tyrosine kinase | ||||||||||
Synonyms | TEL|TEL/ABL|THC5 | IMD82|p72-Syk | ||||||||||
Cytomap | 12p13.2 | 9q22.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | transcription factor ETV6ETS-related protein Tel1ETV6-RUNX1 fusion proteinTEL1 oncogeneets variant gene 6 (TEL oncogene) | tyrosine-protein kinase SYKspleen tyrosine kinase | ||||||||||
Modification date | 20240305 | 20240411 | ||||||||||
UniProtAcc | P41212 | P43405 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000396373, ENST00000544715, | ENST00000375746, ENST00000476708, ENST00000375747, ENST00000375751, ENST00000375754, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: ETV6 [Title/Abstract] AND SYK [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ETV6 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 10514502 |
Tgene | SYK | GO:0006468 | protein phosphorylation | 17681949 |
Tgene | SYK | GO:0007159 | leukocyte cell-cell adhesion | 12885943 |
Tgene | SYK | GO:0018108 | peptidyl-tyrosine phosphorylation | 11606584 |
Tgene | SYK | GO:0030593 | neutrophil chemotaxis | 12885943 |
Tgene | SYK | GO:0035556 | intracellular signal transduction | 11606584|15509800 |
Tgene | SYK | GO:1904263 | positive regulation of TORC1 signaling | 34634301 |
Kinase Fusion gene breakpoints across ETV6 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across SYK (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerKB3 | . | ETV6 | chr12 | 12022903 | SYK | chr9 | 93627329 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000396373 | ENST00000375751 | ETV6 | chr12 | 12022903 | SYK | chr9 | 93627329 | 5275 | 683 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000396373_ENST00000375751_ETV6_chr12_12022903_SYK_chr9_93627329_length(amino acids)=683 MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMN GKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMP SPIMHPLILNPRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIAGNVNFGGRPQLPGSHPASSPAQGN RQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVK ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVH RDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVT -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr12:/chr9:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
ETV6 | SYK |
FUNCTION: Transcriptional repressor; binds to the DNA sequence 5'-CCGGAAGT-3'. Plays a role in hematopoiesis and malignant transformation. {ECO:0000269|PubMed:25581430}. | FUNCTION: Non-receptor tyrosine kinase which mediates signal transduction downstream of a variety of transmembrane receptors including classical immunoreceptors like the B-cell receptor (BCR). Regulates several biological processes including innate and adaptive immunity, cell adhesion, osteoclast maturation, platelet activation and vascular development (PubMed:12387735, PubMed:33782605). Assembles into signaling complexes with activated receptors at the plasma membrane via interaction between its SH2 domains and the receptor tyrosine-phosphorylated ITAM domains. The association with the receptor can also be indirect and mediated by adapter proteins containing ITAM or partial hemITAM domains. The phosphorylation of the ITAM domains is generally mediated by SRC subfamily kinases upon engagement of the receptor. More rarely signal transduction via SYK could be ITAM-independent. Direct downstream effectors phosphorylated by SYK include DEPTOR, VAV1, PLCG1, PI-3-kinase, LCP2 and BLNK (PubMed:12456653, PubMed:15388330, PubMed:8657103, PubMed:34634301). Initially identified as essential in B-cell receptor (BCR) signaling, it is necessary for the maturation of B-cells most probably at the pro-B to pre-B transition (PubMed:12456653). Activated upon BCR engagement, it phosphorylates and activates BLNK an adapter linking the activated BCR to downstream signaling adapters and effectors. It also phosphorylates and activates PLCG1 and the PKC signaling pathway. It also phosphorylates BTK and regulates its activity in B-cell antigen receptor (BCR)-coupled signaling. In addition to its function downstream of BCR also plays a role in T-cell receptor signaling. Plays also a crucial role in the innate immune response to fungal, bacterial and viral pathogens. It is for instance activated by the membrane lectin CLEC7A. Upon stimulation by fungal proteins, CLEC7A together with SYK activates immune cells inducing the production of ROS. Also activates the inflammasome and NF-kappa-B-mediated transcription of chemokines and cytokines in presence of pathogens. Regulates neutrophil degranulation and phagocytosis through activation of the MAPK signaling cascade (By similarity). Required for the stimulation of neutrophil phagocytosis by IL15 (PubMed:15123770). Also mediates the activation of dendritic cells by cell necrosis stimuli. Also involved in mast cells activation. Involved in interleukin-3/IL3-mediated signaling pathway in basophils (By similarity). Also functions downstream of receptors mediating cell adhesion (PubMed:12387735). Relays for instance, integrin-mediated neutrophils and macrophages activation and P-selectin receptor/SELPG-mediated recruitment of leukocytes to inflammatory loci. Also plays a role in non-immune processes. It is for instance involved in vascular development where it may regulate blood and lymphatic vascular separation. It is also required for osteoclast development and function. Functions in the activation of platelets by collagen, mediating PLCG2 phosphorylation and activation. May be coupled to the collagen receptor by the ITAM domain-containing FCER1G. Also activated by the membrane lectin CLEC1B that is required for activation of platelets by PDPN/podoplanin. Involved in platelet adhesion being activated by ITGB3 engaged by fibrinogen. Together with CEACAM20, enhances production of the cytokine CXCL8/IL-8 via the NFKB pathway and may thus have a role in the intestinal immune response (By similarity). {ECO:0000250|UniProtKB:P48025, ECO:0000269|PubMed:12387735, ECO:0000269|PubMed:12456653, ECO:0000269|PubMed:15123770, ECO:0000269|PubMed:15388330, ECO:0000269|PubMed:19909739, ECO:0000269|PubMed:33782605, ECO:0000269|PubMed:34634301, ECO:0000269|PubMed:8657103, ECO:0000269|PubMed:9535867}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | ETV6 | 12022903 | SYK | 93627329 | ENST00000396373 | 4 | 13 | 371_631 | 265 | 613 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | ETV6 | 12022903 | SYK | 93627329 | ENST00000396373 | 4 | 14 | 371_631 | 265 | 636 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>180_ETV6_SYK | ENST00000396373 | ENST00000375751 | ETV6 | chr12 | 12022903 | SYK | chr9 | 93627329 | MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMN GKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMP SPIMHPLILNPRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIAGNVNFGGRPQLPGSHPASSPAQGN RQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVK ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVH RDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVT | 683 |
3D view using mol* of 180_ETV6_SYK | ||||||||||
PDB file >>>TKFP_326_ETV6_SYK | ENST00000396373 | ENST00000375751 | ETV6 | chr12 | 12022903 | SYK | chr9 | 93627329 | MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMN GKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMP SPIMHPLILNPRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIAGNVNFGGRPQLPGSHPASSPAQGN RQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVK ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVH RDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVT | 683_ETV6_SYK |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
180_ETV6_SYK.png |
180_ETV6_SYK.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
180_ETV6_SYK_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
180_ETV6_SYK-DOCK_HTVS_1-001 | Midostaurin | -5.70504 | -5.70504 | -45.5701 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Neratinib | -5.464180000000001 | -5.64648 | -51.2854 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Neratinib | -5.464180000000001 | -5.64648 | -51.2854 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Larotrectinib | -5.25777 | -5.25777 | -38.5575 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Neratinib | -5.25553 | -5.44143 | -48.4944 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Dacomitinib | -5.12721 | -5.23621 | -47.0168 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Lapatinib | -4.999569999999999 | -5.088369999999999 | -49.0274 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Pralsetinib | -4.9505099999999995 | -5.042009999999999 | -48.3499 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Midostaurin | -4.94883 | -4.94883 | -46.1499 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Larotrectinib | -4.9313 | -4.9313 | -42.7152 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Dacomitinib | -4.85365 | -4.96195 | -46.653 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Dacomitinib | -4.85365 | -4.96195 | -46.653 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Ponatinib | -4.81951 | -5.02611 | -48.0996 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Ponatinib | -4.81951 | -5.02611 | -48.0996 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Ponatinib | -4.81951 | -5.02611 | -48.0996 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Cabozantinib | -4.793019999999999 | -4.838019999999999 | -44.3595 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Cabozantinib | -4.793019999999999 | -4.838019999999999 | -44.3595 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Pralsetinib | -4.7424800000000005 | -4.83398 | -44.7838 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Neratinib | -4.69371 | -4.87961 | -45.4631 |
180_ETV6_SYK-DOCK_HTVS_1-001 | Tofacitinib | -4.65564 | -4.66714 | -27.756999999999998 |
Top |
Kinase-Substrate Information of ETV6_SYK |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
SYK | P43405 | human | SLC4A1 | P02730 | Y904 | EEEGRDEyDEVAMPV | |
SYK | P43405 | human | GCSAM | Q8N6F7 | Y106 | sGNsAEEyyENVPCk | HGAL |
SYK | P43405 | human | SHC1 | P29353-2 | Y317 | ELFDDPSyVNVQNLD | |
SYK | P43405 | human | FCGR2C | P31995 | Y310 | tDDDKNIyLTLPPND | |
SYK | P43405 | human | PRDX2 | P32119 | Y193 | NVDDskEyFskHN__ | 1-cysPrx_C |
SYK | P43405 | human | SLC4A1 | P02730 | Y21 | ENLEQEEyEDPDIPE | |
SYK | P43405 | human | LAX1 | Q8IWV1 | Y268 | SSQISNDyVNMTGLD | LAX |
SYK | P43405 | human | SLC4A1 | P02730 | Y8 | MEELQDDyEDMMEEN | |
SYK | P43405 | human | PLCG1 | P19174 | Y771 | IGtAEPdyGALyEGR | |
SYK | P43405 | human | BLNK | Q8WV28 | Y96 | EENADDSyEPPPVEQ | |
SYK | P43405 | human | PLCG2 | P16885 | Y759 | LyDVsRMyVDPsEIN | |
SYK | P43405 | human | HCLS1 | P14317 | Y378 | EPEPENDyEDVEEMD | |
SYK | P43405 | human | SHC1 | P29353-2 | Y239 | EEPPDHQyyNDFPGK | |
SYK | P43405 | human | FCGR2A | P12318 | Y304 | tDDDKNIyLTLPPND | |
SYK | P43405 | human | IKZF1 | Q13422 | S361 | LAEGtPRsNHsAQDs | |
SYK | P43405 | human | CFTR | P13569 | Y512 | NIIFGVsyDEyRYRS | ABC_tran |
SYK | P43405 | human | LAT2 | Q9GZY6 | Y233 | EEDGEPDyVNGEVAA | LAT2 |
SYK | P43405 | human | IKZF1 | Q13422 | S364 | GtPRsNHsAQDsAVE | |
SYK | P43405 | human | DEPTOR | Q8TB45 | Y289 | ssCGssGyFsssPtL | |
SYK | P43405 | human | CTTN | Q14247 | Y421 | rLPssPVyEDAAsFK | |
SYK | P43405 | human | ARHGDIB | P52566 | Y24 | ELdskLNykPPPQks | Rho_GDI |
SYK | P43405 | human | BLNK | Q8WV28 | Y84 | EHSDSEMyVMPAEEN | |
SYK | P43405 | human | PLCG1 | P19174 | Y783 | EGRNPGFyVEANPMP | |
SYK | P43405 | human | STAT5A | P42229 | Y694 | LAkAVDGyVkPQIkQ | |
SYK | P43405 | human | LAT2 | Q9GZY6 | Y193 | EDEEsEDyQNsAsIH | LAT2 |
SYK | P43405 | human | CBL | P22681 | Y700 | EGEEDtEyMtPssRP | |
SYK | P43405 | human | FCGR2C | P31995 | Y287 | PEETNNDyETADGGy | |
SYK | P43405 | human | GCSAM | Q8N6F7 | Y86 | tysEELCytLINHRV | HGAL |
SYK | P43405 | human | SLC4A1 | P02730 | Y359 | AKPDssFyKGLDLNG | |
SYK | P43405 | human | SNCA | P37840 | Y133 | EMPsEEGyQDyEPEA | |
SYK | P43405 | human | SHC1 | P29353-2 | Y240 | EPPDHQyyNDFPGKE | |
SYK | P43405 | human | LAT2 | Q9GZY6 | Y136 | EDDDANsyENVLICK | LAT2 |
SYK | P43405 | human | SNCA | P37840 | Y136 | sEEGyQDyEPEA___ | |
SYK | P43405 | human | DUSP3 | P51452 | Y138 | SPTLVIAyLMMRQKM | DSPc |
SYK | P43405 | human | SYK | P43405 | Y352 | tEVyEsPyADPEEIR | |
SYK | P43405 | human | SNCA | P37840 | Y125 | VDPDNEAyEMPsEEG | Synuclein |
SYK | P43405 | human | DOCK2 | Q92608 | Y224 | SsPTHsLyVFVRNFV | DOCK_N |
SYK | P43405 | human | BLNK | Q8WV28 | Y178 | LLEDEADyVVPVEDN | |
SYK | P43405 | human | FCGR2A | P12318 | Y281 | LEEtNNDyEtADGGy | |
SYK | P43405 | human | DOCK2 | Q92608 | Y122 | LQVQSMMyDLMEWRS | DOCK_N |
SYK | P43405 | human | DOCK2 | Q92608 | Y985 | DLIGKNVyPGDWMAM | |
SYK | P43405 | human | BTK | Q06187 | Y551 | RYVLDDEytsSVGSk | PK_Tyr_Ser-Thr |
SYK | P43405 | human | LAX1 | Q8IWV1 | Y294 | AFQCCRDyENVPAAD | LAX |
SYK | P43405 | human | GCSAM | Q8N6F7 | Y128 | LGGTEtEySLLHMPS | HGAL |
SYK | P43405 | human | SYK | P43405 | Y348 | LPMDtEVyEsPyADP | |
SYK | P43405 | human | CBL | P22681 | Y774 | sENEDDGyDVPKPPV | |
SYK | P43405 | human | DUSP3 | P51452 | Y38 | NEVTPRIyVGNASVA | DSPc |
SYK | P43405 | human | GCSAM | Q8N6F7 | Y107 | GNsAEEyyENVPCkA | HGAL |
SYK | P43405 | human | CBL | P22681 | Y731 | QQIDSCTyEAMyNIQ | |
SYK | P43405 | human | BLNK | Q8WV28 | Y72 | SDDFDSDyENPDEHS | |
SYK | P43405 | human | LAX1 | Q8IWV1 | Y373 | SNEDSSDyENVLTAK | LAX |
SYK | P43405 | human | MAPT | P10636 | Y18 | MEDHAGTyGLGDRKD | |
SYK | P43405 | human | GCSAM | Q8N6F7 | Y80 | QDNVDQtysEELCyt | HGAL |
SYK | P43405 | human | SYK | P43405 | Y525 | ALRADENyykAQtHG | PK_Tyr_Ser-Thr |
SYK | P43405 | human | PTPN11 | Q06124 | Y542 | sKRkGHEytNIKysL | |
SYK | P43405 | human | RHBG | Q9H310 | Y429 | SPPDSQHyEDQVHWQ | |
SYK | P43405 | human | LCP2 | Q13094 | Y113 | ssFEEDDyESPNDDQ | |
SYK | P43405 | human | SYK | P43405 | Y526 | LRADENyykAQtHGK | PK_Tyr_Ser-Thr |
SYK | P43405 | human | BLNK | Q8WV28 | Y189 | VEDNDENyIHPtESS | |
SYK | P43405 | human | HCLS1 | P14317 | Y397 | EDEPEGDyEEVLEPE | |
SYK | P43405 | human | DOCK2 | Q92608 | Y1405 | VkNAPGQyIQCFTVQ | DHR-2_Lobe_B |
SYK | P43405 | human | STAT1 | P42224 | Y701 | DGPkGtGyIktELIs | |
SYK | P43405 | human | PIP5K1B | O14986 | Y105 | FGIKPDDyLYSICSE | |
SYK | P43405 | human | LCP2 | Q13094 | Y128 | DGEDDGDyEsPNEEE | |
SYK | P43405 | human | STING1 | Q86WV6 | Y240 | AGIKDRVysNSIyEL | TMEM173 |
SYK | P43405 | human | LAX1 | Q8IWV1 | Y193 | SSEDSHDyVNVPTAE | LAX |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
SYK | ID | Description | 0.00e+00 |
SYK | GO:0050851 | antigen receptor-mediated signaling pathway | 9.96e-10 |
SYK | GO:0002429 | immune response-activating cell surface receptor signaling pathway | 3.67e-08 |
SYK | GO:0002757 | immune response-activating signaling pathway | 3.67e-08 |
SYK | GO:0002768 | immune response-regulating cell surface receptor signaling pathway | 3.67e-08 |
SYK | GO:0002274 | myeloid leukocyte activation | 3.67e-08 |
SYK | GO:0002764 | immune response-regulating signaling pathway | 5.28e-08 |
SYK | GO:0050853 | B cell receptor signaling pathway | 5.47e-07 |
SYK | GO:0002275 | myeloid cell activation involved in immune response | 2.08e-06 |
SYK | GO:0038095 | Fc-epsilon receptor signaling pathway | 1.22e-05 |
SYK | GO:0045576 | mast cell activation | 1.33e-05 |
SYK | GO:0032481 | positive regulation of type I interferon production | 1.50e-05 |
SYK | GO:0045807 | positive regulation of endocytosis | 2.15e-05 |
SYK | GO:0043254 | regulation of protein-containing complex assembly | 3.20e-05 |
SYK | GO:0033673 | negative regulation of kinase activity | 6.40e-05 |
SYK | GO:0048872 | homeostasis of number of cells | 6.40e-05 |
SYK | GO:0031334 | positive regulation of protein-containing complex assembly | 6.82e-05 |
SYK | GO:0007173 | epidermal growth factor receptor signaling pathway | 7.07e-05 |
SYK | GO:0019722 | calcium-mediated signaling | 8.55e-05 |
SYK | GO:0051348 | negative regulation of transferase activity | 1.13e-04 |
SYK | GO:0032479 | regulation of type I interferon production | 1.13e-04 |
SYK | GO:0032606 | type I interferon production | 1.13e-04 |
SYK | GO:0038127 | ERBB signaling pathway | 1.13e-04 |
SYK | GO:0043303 | mast cell degranulation | 1.15e-04 |
SYK | GO:0002279 | mast cell activation involved in immune response | 1.23e-04 |
SYK | GO:0038093 | Fc receptor signaling pathway | 1.23e-04 |
SYK | GO:0002448 | mast cell mediated immunity | 1.27e-04 |
SYK | GO:0050852 | T cell receptor signaling pathway | 1.93e-04 |
SYK | GO:2000377 | regulation of reactive oxygen species metabolic process | 2.06e-04 |
SYK | GO:2000379 | positive regulation of reactive oxygen species metabolic process | 2.32e-04 |
SYK | GO:0030098 | lymphocyte differentiation | 2.36e-04 |
SYK | GO:0018108 | peptidyl-tyrosine phosphorylation | 2.36e-04 |
SYK | GO:0018212 | peptidyl-tyrosine modification | 2.36e-04 |
SYK | GO:0042113 | B cell activation | 2.36e-04 |
SYK | GO:0030100 | regulation of endocytosis | 2.98e-04 |
SYK | GO:0002366 | leukocyte activation involved in immune response | 3.51e-04 |
SYK | GO:0002262 | myeloid cell homeostasis | 3.55e-04 |
SYK | GO:0002263 | cell activation involved in immune response | 3.56e-04 |
SYK | GO:0043299 | leukocyte degranulation | 3.56e-04 |
SYK | GO:0140029 | exocytic process | 3.64e-04 |
SYK | GO:0019932 | second-messenger-mediated signaling | 3.64e-04 |
SYK | GO:0006469 | negative regulation of protein kinase activity | 3.67e-04 |
SYK | GO:1903131 | mononuclear cell differentiation | 3.68e-04 |
SYK | GO:0032418 | lysosome localization | 3.90e-04 |
SYK | GO:1990849 | vacuolar localization | 3.90e-04 |
SYK | GO:0042326 | negative regulation of phosphorylation | 4.38e-04 |
SYK | GO:0006887 | exocytosis | 6.19e-04 |
SYK | GO:0050764 | regulation of phagocytosis | 6.64e-04 |
SYK | GO:0032755 | positive regulation of interleukin-6 production | 6.76e-04 |
SYK | GO:0050878 | regulation of body fluid levels | 7.48e-04 |
Top |
Related Drugs to ETV6_SYK |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning ETV6-SYK and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to ETV6_SYK |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
ETV6 | SYK | Breast Invasive Ductal Carcinoma | MyCancerGenome | |
ETV6 | SYK | Invasive Breast Carcinoma | MyCancerGenome | |
ETV6 | SYK | Lung Adenocarcinoma | MyCancerGenome | |
ETV6 | SYK | Appendix Adenocarcinoma | MyCancerGenome | |
ETV6 | SYK | Colon Adenocarcinoma | MyCancerGenome |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | ETV6 | C4015537 | THROMBOCYTOPENIA 5 | 4 | CTD_human;GENOMICS_ENGLAND;UNIPROT |
Hgene | ETV6 | C0023485 | Precursor B-Cell Lymphoblastic Leukemia-Lymphoma | 3 | CTD_human |
Hgene | ETV6 | C0040034 | Thrombocytopenia | 3 | CTD_human;GENOMICS_ENGLAND |
Hgene | ETV6 | C0023480 | Leukemia, Myelomonocytic, Chronic | 2 | ORPHANET |
Hgene | ETV6 | C1332965 | Congenital Mesoblastic Nephroma | 2 | ORPHANET |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |