UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:FARP1_STK24 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: FARP1_STK24 | KinaseFusionDB ID: KFG2254 | FusionGDB2.0 ID: KFG2254 | Hgene | Tgene | Gene symbol | FARP1 | STK24 | Gene ID | 10160 | 8428 | |
Gene name | FERM, ARH/RhoGEF and pleckstrin domain protein 1 | serine/threonine kinase 24 | ||||||||||
Synonyms | CDEP|FARP1-IT1|GLCC1|PLEKHC2|PPP1R75 | HEL-S-95|MST3|MST3B|STE20|STK3 | ||||||||||
Cytomap | 13q32.2 | 13q32.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | FERM, ARHGEF and pleckstrin domain-containing protein 1FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)FERM, RhoGEF and pleckstrin domain-containing protein 1PH domain-containing family C member 2chondrocyte-derived ezrin-li | serine/threonine-protein kinase 24STE20-like kinase 3STE20-like kinase MST3epididymis secretory protein Li 95mammalian STE20-like protein kinase 3serine/threonine kinase 24 (STE20 homolog, yeast)sterile 20-like kinase 3 | ||||||||||
Modification date | 20240407 | 20240411 | ||||||||||
UniProtAcc | Q9Y4F1 | Q9Y6E0 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000319562, ENST00000376581, ENST00000376586, ENST00000595437, ENST00000593990, | ENST00000376547, ENST00000481288, ENST00000539966, ENST00000397517, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: FARP1 [Title/Abstract] AND STK24 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | FARP1(98865667)-STK24(99171727), # samples:1 FARP1(98865667)-STK24(99134575), # samples:1 FARP1(98795746)-STK24(99171727), # samples:1 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | STK24 | GO:0006468 | protein phosphorylation | 19604147 |
Tgene | STK24 | GO:0034599 | cellular response to oxidative stress | 22291017 |
Tgene | STK24 | GO:0046777 | protein autophosphorylation | 17046825|17657516 |
Kinase Fusion gene breakpoints across FARP1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across STK24 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-Y8-A8RY-11A | FARP1 | chr13 | 98865667 | STK24 | chr13 | 99171727 |
ChimerDB4 | TCGA-CG-5730-11A | FARP1 | chr13 | 98865667 | STK24 | chr13 | 99134575 |
ChimerDB4 | 5357N | FARP1 | chr13 | 98795746 | STK24 | chr13 | 99171727 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000595437 | ENST00000397517 | FARP1 | chr13 | 98865667 | STK24 | chr13 | 99171727 | 4636 | 474 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000595437_ENST00000397517_FARP1_chr13_98865667_STK24_chr13_99171727_length(amino acids)=474 MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQ KVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHS EKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKV LFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQAS GGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGIS -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr13:98865667/chr13:99171727) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
FARP1 | STK24 |
FUNCTION: Functions as a guanine nucleotide exchange factor for RAC1. May play a role in semaphorin signaling. Plays a role in the assembly and disassembly of dendritic filopodia, the formation of dendritic spines, regulation of dendrite length and ultimately the formation of synapses (By similarity). {ECO:0000250}. | FUNCTION: Serine/threonine-protein kinase that acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation. Mediates oxidative-stress-induced cell death by modulating phosphorylation of JNK1-JNK2 (MAPK8 and MAPK9), p38 (MAPK11, MAPK12, MAPK13 and MAPK14) during oxidative stress. Plays a role in a staurosporine-induced caspase-independent apoptotic pathway by regulating the nuclear translocation of AIFM1 and ENDOG and the DNase activity associated with ENDOG. Phosphorylates STK38L on 'Thr-442' and stimulates its kinase activity. In association with STK26 negatively regulates Golgi reorientation in polarized cell migration upon RHO activation (PubMed:27807006). Regulates also cellular migration with alteration of PTPN12 activity and PXN phosphorylation: phosphorylates PTPN12 and inhibits its activity and may regulate PXN phosphorylation through PTPN12. May act as a key regulator of axon regeneration in the optic nerve and radial nerve. {ECO:0000269|PubMed:16314523, ECO:0000269|PubMed:17046825, ECO:0000269|PubMed:19604147, ECO:0000269|PubMed:19782762, ECO:0000269|PubMed:19855390, ECO:0000269|PubMed:27807006}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | FARP1 | 98865667 | STK24 | 99171727 | ENST00000595437 | 0 | 11 | 36_286 | 14 | 432 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | FARP1 | 98865667 | STK24 | 99171727 | ENST00000595437 | 0 | 11 | 36_286 | 26 | 444 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>193_FARP1_STK24 | ENST00000595437 | ENST00000397517 | FARP1 | chr13 | 98865667 | STK24 | chr13 | 99171727 | MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQ KVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHS EKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKV LFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQAS GGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGIS | 474 |
3D view using mol* of 193_FARP1_STK24 | ||||||||||
PDB file >>>TKFP_347_FARP1_STK24 | ENST00000595437 | ENST00000397517 | FARP1 | chr13 | 98865667 | STK24 | chr13 | 99171727 | MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQ KVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHS EKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKV LFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQAS GGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGIS | 474_FARP1_STK24 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
193_FARP1_STK24.png |
193_FARP1_STK24.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
193_FARP1_STK24_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
193_FARP1_STK24-DOCK_HTVS_1-001 | Trametinib | -6.333019999999999 | -6.333019999999999 | -39.3533 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Fostamatinib | -5.89921 | -5.96281 | -48.7977 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Fostamatinib | -5.89921 | -5.96281 | -48.7977 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Pexidartinib | -5.84596 | -6.06276 | -5.92227 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Pexidartinib | -5.84596 | -6.06276 | -5.92227 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Larotrectinib | -5.7014 | -5.7014 | -41.293 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Upadacitinib | -5.53404 | -5.53504 | -33.7278 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Tofacitinib | -5.53291 | -5.54441 | -27.7621 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Tofacitinib | -5.53291 | -5.54441 | -27.7621 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Capmatinib | -5.50561 | -5.51121 | -38.1418 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Upadacitinib | -5.46148 | -5.46248 | -35.7265 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Netarsudil | -5.4239 | -5.435 | -49.2337 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Netarsudil | -5.4239 | -5.435 | -49.2337 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Tofacitinib | -5.3750800000000005 | -5.38658 | -27.3089 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Tofacitinib | -5.3750800000000005 | -5.38658 | -27.3089 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Abrocitinib | -5.34779 | -5.35889 | -34.7382 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Abrocitinib | -5.34779 | -5.35889 | -34.7382 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Tucatinib | -5.31004 | -5.68524 | -48.6199 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Axitinib | -5.25135 | -5.25455 | -38.3329 |
193_FARP1_STK24-DOCK_HTVS_1-001 | Nilotinib | -5.23581 | -5.37541 | -48.8919 |
Top |
Kinase-Substrate Information of FARP1_STK24 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
STK24 | Q9Y6E0 | human | PRKAA1 | Q13131 | T183 | sDGEFLRtsCGsPNy | Pkinase |
STK24 | Q9Y6E0 | human | PPP1R14C | Q8TAE6 | T73 | RHQQGKVtVkYDRKE | PP1_inhibitor |
STK24 | Q9Y6E0 | human | TAOK1 | Q7L7X3 | T440 | RNREHFAtIRtAsLV | |
STK24 | Q9Y6E0 | human | SIK2 | Q9H0K1 | T175 | kSGELLAtWCGSPPY | Pkinase |
STK24 | Q9Y6E0 | human | RAB8A | P61006 | T72 | AGQERFRtITTAyyR | Ras |
STK24 | Q9Y6E0 | human | STK24 | Q9Y6E0 | T190 | DtQIkRNtFVGtPFW | Pkinase |
STK24 | Q9Y6E0 | human | SIK1 | P57059 | T182 | kSGEPLStWCGSPPY | Pkinase |
STK24 | Q9Y6E0 | human | SIK3 | Q9Y2K2 | T221 | TPGQLLKtWCGSPPY | Pkinase |
STK24 | Q9Y6E0 | human | STK38L | Q9Y2H1 | T442 | DWVFLNytyKRFEGL | Pkinase_C |
STK24 | Q9Y6E0 | human | PRKAA2 | P54646 | T172 | sDGEFLRtsCGsPNy | Pkinase |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
STK24 | ID | Description | 0.00e+00 |
STK24 | GO:1901985 | positive regulation of protein acetylation | 1.01e-04 |
STK24 | GO:1901983 | regulation of protein acetylation | 2.52e-04 |
STK24 | GO:0046777 | protein autophosphorylation | 3.31e-04 |
STK24 | GO:1903943 | regulation of hepatocyte apoptotic process | 1.12e-03 |
STK24 | GO:1903432 | regulation of TORC1 signaling | 1.12e-03 |
STK24 | GO:0038202 | TORC1 signaling | 1.13e-03 |
STK24 | GO:0006473 | protein acetylation | 1.14e-03 |
STK24 | GO:0010506 | regulation of autophagy | 1.14e-03 |
STK24 | GO:0042752 | regulation of circadian rhythm | 1.14e-03 |
STK24 | GO:0071380 | cellular response to prostaglandin E stimulus | 1.14e-03 |
STK24 | GO:2000758 | positive regulation of peptidyl-lysine acetylation | 1.14e-03 |
STK24 | GO:0055089 | fatty acid homeostasis | 1.18e-03 |
STK24 | GO:0071379 | cellular response to prostaglandin stimulus | 1.30e-03 |
STK24 | GO:0090043 | regulation of tubulin deacetylation | 1.30e-03 |
STK24 | GO:0097284 | hepatocyte apoptotic process | 1.30e-03 |
STK24 | GO:0032006 | regulation of TOR signaling | 1.30e-03 |
STK24 | GO:0043543 | protein acylation | 1.30e-03 |
STK24 | GO:0045821 | positive regulation of glycolytic process | 1.34e-03 |
STK24 | GO:0090042 | tubulin deacetylation | 1.38e-03 |
STK24 | GO:0034695 | response to prostaglandin E | 1.38e-03 |
STK24 | GO:0070507 | regulation of microtubule cytoskeleton organization | 1.38e-03 |
STK24 | GO:0031929 | TOR signaling | 1.47e-03 |
STK24 | GO:2000756 | regulation of peptidyl-lysine acetylation | 1.65e-03 |
STK24 | GO:0009267 | cellular response to starvation | 1.65e-03 |
STK24 | GO:0006109 | regulation of carbohydrate metabolic process | 1.84e-03 |
STK24 | GO:0034063 | stress granule assembly | 1.86e-03 |
STK24 | GO:0034694 | response to prostaglandin | 1.91e-03 |
STK24 | GO:0007623 | circadian rhythm | 1.99e-03 |
STK24 | GO:0032869 | cellular response to insulin stimulus | 1.99e-03 |
STK24 | GO:0034389 | lipid droplet organization | 1.99e-03 |
STK24 | GO:0090311 | regulation of protein deacetylation | 1.99e-03 |
STK24 | GO:0042594 | response to starvation | 2.22e-03 |
STK24 | GO:0031669 | cellular response to nutrient levels | 3.27e-03 |
STK24 | GO:1904262 | negative regulation of TORC1 signaling | 3.29e-03 |
STK24 | GO:0032886 | regulation of microtubule-based process | 3.34e-03 |
STK24 | GO:0042149 | cellular response to glucose starvation | 3.51e-03 |
STK24 | GO:0032868 | response to insulin | 3.57e-03 |
STK24 | GO:0006110 | regulation of glycolytic process | 3.60e-03 |
STK24 | GO:0031668 | cellular response to extracellular stimulus | 3.85e-03 |
STK24 | GO:0006476 | protein deacetylation | 4.24e-03 |
STK24 | GO:0048511 | rhythmic process | 4.24e-03 |
STK24 | GO:0006695 | cholesterol biosynthetic process | 4.24e-03 |
STK24 | GO:1902653 | secondary alcohol biosynthetic process | 4.24e-03 |
STK24 | GO:0071375 | cellular response to peptide hormone stimulus | 4.37e-03 |
STK24 | GO:0043470 | regulation of carbohydrate catabolic process | 4.37e-03 |
STK24 | GO:0070050 | neuron cellular homeostasis | 4.37e-03 |
STK24 | GO:1904036 | negative regulation of epithelial cell apoptotic process | 4.41e-03 |
STK24 | GO:0016126 | sterol biosynthetic process | 4.59e-03 |
STK24 | GO:0035601 | protein deacylation | 4.59e-03 |
Top |
Related Drugs to FARP1_STK24 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning FARP1-STK24 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to FARP1_STK24 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |