UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:FRK_XRCC4 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: FRK_XRCC4 | KinaseFusionDB ID: KFG2427 | FusionGDB2.0 ID: KFG2427 | Hgene | Tgene | Gene symbol | FRK | XRCC4 | Gene ID | 2444 | 7518 | |
Gene name | fyn related Src family tyrosine kinase | X-ray repair cross complementing 4 | ||||||||||
Synonyms | GTK|PTK5|RAK | SSMED|hXRCC4 | ||||||||||
Cytomap | 6q22.1 | 5q14.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | tyrosine-protein kinase FRKPTK5 protein tyrosine kinase 5fyn-related kinasenuclear tyrosine protein kinase RAKprotein-tyrosine kinase 5 | DNA repair protein XRCC4X-ray repair complementing defective repair in Chinese hamster cells 4 | ||||||||||
Modification date | 20240411 | 20240305 | ||||||||||
UniProtAcc | P42685 | Q13426 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000606080, ENST00000538210, | ENST00000282268, ENST00000338635, ENST00000396027, ENST00000511817, ENST00000509268, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: FRK [Title/Abstract] AND XRCC4 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | FRK | GO:0000122 | negative regulation of transcription by RNA polymerase II | 12837246 |
Tgene | XRCC4 | GO:0006302 | double-strand break repair | 9242410 |
Tgene | XRCC4 | GO:0006303 | double-strand break repair via nonhomologous end joining | 12517771|15385968|17290226|25597996|25934149|26774286|27437582|28500754 |
Tgene | XRCC4 | GO:0010165 | response to X-ray | 9242410 |
Tgene | XRCC4 | GO:0051103 | DNA ligation involved in DNA repair | 12517771|15385968|17290226|28453785 |
Tgene | XRCC4 | GO:0051351 | positive regulation of ligase activity | 9242410 |
Tgene | XRCC4 | GO:1990166 | protein localization to site of double-strand break | 31548606 |
Kinase Fusion gene breakpoints across FRK (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across XRCC4 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
CCLE | CCLF_UPGI_0040_T | FRK | chr6 | 116288714 | XRCC4 | chr5 | 82648944 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000606080 | ENST00000511817 | FRK | chr6 | 116288714 | XRCC4 | chr5 | 82648944 | 1909 | 289 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000606080_ENST00000511817_FRK_chr6_116288714_XRCC4_chr5_82648944_length(amino acids)=289 MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARHLEKRRD GSSQQLQGYIPSNYVAEDRSLQAEPWFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRR RIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPVLGL -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr6:/chr5:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
FRK | XRCC4 |
FUNCTION: Non-receptor tyrosine-protein kinase that negatively regulates cell proliferation. Positively regulates PTEN protein stability through phosphorylation of PTEN on 'Tyr-336', which in turn prevents its ubiquitination and degradation, possibly by reducing its binding to NEDD4. May function as a tumor suppressor. {ECO:0000269|PubMed:19345329}. | FUNCTION: [DNA repair protein XRCC4]: DNA non-homologous end joining (NHEJ) core factor, required for double-strand break repair and V(D)J recombination (PubMed:10757784, PubMed:10854421, PubMed:17124166, PubMed:16412978, PubMed:8548796, PubMed:25742519, PubMed:12517771, PubMed:17290226, PubMed:22228831, PubMed:25597996, PubMed:25934149, PubMed:26100018, PubMed:26774286). Acts as a scaffold protein that regulates recruitment of other proteins to DNA double-strand breaks (DSBs) (PubMed:15385968, PubMed:20852255, PubMed:26774286, PubMed:27437582). Associates with NHEJ1/XLF to form alternating helical filaments that bridge DNA and act like a bandage, holding together the broken DNA until it is repaired (PubMed:26100018, PubMed:27437582, PubMed:28500754, PubMed:21775435, PubMed:22287571, PubMed:21768349). The XRCC4-NHEJ1/XLF subcomplex binds to the DNA fragments of a DSB in a highly diffusive manner and robustly bridges two independent DNA molecules, holding the broken DNA fragments in close proximity to one other (PubMed:27437582). The mobility of the bridges ensures that the ends remain accessible for further processing by other repair factors (PubMed:27437582). Plays a key role in the NHEJ ligation step of the broken DNA during DSB repair via direct interaction with DNA ligase IV (LIG4): the LIG4-XRCC4 subcomplex reseals the DNA breaks after the gap filling is completed (PubMed:9242410, PubMed:10757784, PubMed:10854421, PubMed:12517771, PubMed:17290226, PubMed:19837014). XRCC4 stabilizes LIG4, regulates its subcellular localization and enhances LIG4's joining activity (PubMed:9242410, PubMed:10757784, PubMed:10854421, PubMed:12517771, PubMed:17290226, PubMed:21982441, PubMed:22228831). Binding of the LIG4-XRCC4 subcomplex to DNA ends is dependent on the assembly of the DNA-dependent protein kinase complex DNA-PK to these DNA ends (PubMed:10757784, PubMed:10854421). Promotes displacement of PNKP from processed strand break termini (PubMed:20852255, PubMed:28453785). {ECO:0000269|PubMed:10757784, ECO:0000269|PubMed:10854421, ECO:0000269|PubMed:12517771, ECO:0000269|PubMed:15385968, ECO:0000269|PubMed:16412978, ECO:0000269|PubMed:17124166, ECO:0000269|PubMed:17290226, ECO:0000269|PubMed:19837014, ECO:0000269|PubMed:20852255, ECO:0000269|PubMed:21768349, ECO:0000269|PubMed:21775435, ECO:0000269|PubMed:21982441, ECO:0000269|PubMed:22228831, ECO:0000269|PubMed:22287571, ECO:0000269|PubMed:25597996, ECO:0000269|PubMed:25742519, ECO:0000269|PubMed:25934149, ECO:0000269|PubMed:26100018, ECO:0000269|PubMed:26774286, ECO:0000269|PubMed:27437582, ECO:0000269|PubMed:28453785, ECO:0000269|PubMed:28500754, ECO:0000269|PubMed:8548796, ECO:0000269|PubMed:9242410}.; FUNCTION: [Protein XRCC4, C-terminus]: Acts as an activator of the phospholipid scramblase activity of XKR4 (PubMed:33725486). This form, which is generated upon caspase-3 (CASP3) cleavage, translocates into the cytoplasm and interacts with XKR4, thereby promoting phosphatidylserine scramblase activity of XKR4 and leading to phosphatidylserine exposure on apoptotic cell surface (PubMed:33725486). {ECO:0000269|PubMed:33725486}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Hgene | FRK | 116288714 | XRCC4 | 82648944 | ENST00000606080 | 4 | 8 | 116_208 | 2661 | 506 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Hgene | FRK | 116288714 | XRCC4 | 82648944 | ENST00000606080 | 4 | 8 | 42_110 | 2661 | 506 | Domain | Note=SH3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00192 |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>127_FRK_XRCC4 | ENST00000606080 | ENST00000511817 | FRK | chr6 | 116288714 | XRCC4 | chr5 | 82648944 | MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARHLEKRRD GSSQQLQGYIPSNYVAEDRSLQAEPWFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRR RIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPVLGL | 289 |
3D view using mol* of 127_FRK_XRCC4 | ||||||||||
PDB file >>>HKFP_186_FRK_XRCC4 | ENST00000606080 | ENST00000511817 | FRK | chr6 | 116288714 | XRCC4 | chr5 | 82648944 | MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARHLEKRRD GSSQQLQGYIPSNYVAEDRSLQAEPWFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRR RIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPVLGL | 289_FRK_XRCC4 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
127_FRK_XRCC4.png |
127_FRK_XRCC4.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
127_FRK_XRCC4_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Lapatinib | -7.86423 | -7.95303 | -66.5362 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Belumosudil | -7.6405199999999995 | -7.648219999999999 | -54.1619 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Osimertinib | -7.4747 | -7.4824 | -60.1601 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Ponatinib | -7.25357 | -8.00827 | -55.7868 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Ponatinib | -7.25357 | -8.00827 | -55.7868 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Ponatinib | -7.25357 | -8.00827 | -55.7868 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Afatinib | -7.247539999999999 | -7.4298399999999996 | -53.863 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Afatinib | -7.247539999999999 | -7.4298399999999996 | -53.863 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Afatinib | -7.24614 | -7.4298399999999996 | -53.863 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Belumosudil | -7.182810000000001 | -7.190510000000001 | -52.3808 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Cabozantinib | -7.157589999999999 | -7.20259 | -52.0787 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Cabozantinib | -7.157589999999999 | -7.20259 | -52.0787 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Mobocertinib | -7.0991100000000005 | -7.10681 | -58.2986 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Ponatinib | -7.05057 | -7.2571699999999995 | -47.8522 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Ponatinib | -7.05057 | -7.2571699999999995 | -47.8522 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Ponatinib | -7.05057 | -7.2571699999999995 | -47.8522 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Lapatinib | -7.042889999999999 | -7.131689999999999 | -65.6881 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Larotrectinib | -6.8681399999999995 | -6.8681399999999995 | -43.621 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Neratinib | -6.83812 | -7.02402 | -28.473000000000003 |
127_FRK_XRCC4-DOCK_HTVS_1-001 | Dacomitinib | -6.805860000000001 | -6.914160000000001 | -48.6029 |
Top |
Kinase-Substrate Information of FRK_XRCC4 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
FRK | P42685 | human | YAP1 | P46937 | Y407 | sGLsMsSySVPRtPD | |
FRK | P42685 | human | BRCA1 | P38398 | Y1552 | HDLtEtSyLPRQDLE | |
FRK | P42685 | human | YAP1 | P46937 | Y444 | QQNRFPDyLEAIPGT | |
FRK | P42685 | human | YAP1 | P46937 | Y391 | PFLNsGtyHSRDEst | |
FRK | P42685 | human | PTEN | P60484 | Y336 | NKDkANRyFSPNFKV | PTEN_C2 |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
FRK | ID | Description | 0.00e+00 |
FRK | GO:2001236 | regulation of extrinsic apoptotic signaling pathway | 3.04e-04 |
FRK | GO:0097191 | extrinsic apoptotic signaling pathway | 4.65e-04 |
FRK | GO:0071214 | cellular response to abiotic stimulus | 7.24e-04 |
FRK | GO:0104004 | cellular response to environmental stimulus | 7.24e-04 |
FRK | GO:2001233 | regulation of apoptotic signaling pathway | 8.80e-04 |
FRK | GO:0033146 | regulation of intracellular estrogen receptor signaling pathway | 8.80e-04 |
FRK | GO:1902116 | negative regulation of organelle assembly | 1.31e-03 |
FRK | GO:1902041 | regulation of extrinsic apoptotic signaling pathway via death domain receptors | 1.36e-03 |
FRK | GO:0030520 | intracellular estrogen receptor signaling pathway | 1.41e-03 |
FRK | GO:0071479 | cellular response to ionizing radiation | 2.12e-03 |
FRK | GO:0033143 | regulation of intracellular steroid hormone receptor signaling pathway | 2.12e-03 |
FRK | GO:0008625 | extrinsic apoptotic signaling pathway via death domain receptors | 2.70e-03 |
FRK | GO:0046620 | regulation of organ growth | 3.07e-03 |
FRK | GO:2001237 | negative regulation of extrinsic apoptotic signaling pathway | 3.07e-03 |
FRK | GO:0031398 | positive regulation of protein ubiquitination | 3.54e-03 |
FRK | GO:0030518 | intracellular steroid hormone receptor signaling pathway | 4.08e-03 |
FRK | GO:1903322 | positive regulation of protein modification by small protein conjugation or removal | 4.40e-03 |
FRK | GO:0010212 | response to ionizing radiation | 4.40e-03 |
FRK | GO:0043401 | steroid hormone mediated signaling pathway | 4.40e-03 |
FRK | GO:1901875 | positive regulation of post-translational protein modification | 5.55e-03 |
FRK | GO:0035265 | organ growth | 6.53e-03 |
FRK | GO:0071478 | cellular response to radiation | 6.53e-03 |
FRK | GO:0031345 | negative regulation of cell projection organization | 6.74e-03 |
FRK | GO:0009755 | hormone-mediated signaling pathway | 6.74e-03 |
FRK | GO:1901991 | negative regulation of mitotic cell cycle phase transition | 6.74e-03 |
FRK | GO:0031396 | regulation of protein ubiquitination | 6.75e-03 |
FRK | GO:0071383 | cellular response to steroid hormone stimulus | 7.03e-03 |
FRK | GO:1902115 | regulation of organelle assembly | 7.44e-03 |
FRK | GO:1903320 | regulation of protein modification by small protein conjugation or removal | 8.17e-03 |
FRK | GO:2001234 | negative regulation of apoptotic signaling pathway | 8.17e-03 |
FRK | GO:0033002 | muscle cell proliferation | 8.17e-03 |
FRK | GO:0045926 | negative regulation of growth | 8.17e-03 |
FRK | GO:0045930 | negative regulation of mitotic cell cycle | 8.17e-03 |
FRK | GO:1901988 | negative regulation of cell cycle phase transition | 9.89e-03 |
FRK | GO:1901873 | regulation of post-translational protein modification | 1.01e-02 |
FRK | GO:0060070 | canonical Wnt signaling pathway | 1.19e-02 |
FRK | GO:0010948 | negative regulation of cell cycle process | 1.19e-02 |
FRK | GO:0060485 | mesenchyme development | 1.19e-02 |
FRK | GO:0048638 | regulation of developmental growth | 1.19e-02 |
FRK | GO:0048545 | response to steroid hormone | 1.19e-02 |
FRK | GO:0030522 | intracellular receptor signaling pathway | 1.31e-02 |
FRK | GO:1901990 | regulation of mitotic cell cycle phase transition | 1.31e-02 |
FRK | GO:0010639 | negative regulation of organelle organization | 1.34e-02 |
FRK | GO:0050767 | regulation of neurogenesis | 1.45e-02 |
FRK | GO:0045786 | negative regulation of cell cycle | 1.45e-02 |
FRK | GO:0140694 | non-membrane-bounded organelle assembly | 1.45e-02 |
FRK | GO:0001558 | regulation of cell growth | 1.45e-02 |
FRK | GO:0042060 | wound healing | 1.45e-02 |
FRK | GO:0007059 | chromosome segregation | 1.45e-02 |
Top |
Related Drugs to FRK_XRCC4 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning FRK-XRCC4 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to FRK_XRCC4 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |