UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:HMGA2_TBK1 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: HMGA2_TBK1 | KinaseFusionDB ID: KFG2728 | FusionGDB2.0 ID: KFG2728 | Hgene | Tgene | Gene symbol | HMGA2 | TBK1 | Gene ID | 8091 | 29110 | |
Gene name | high mobility group AT-hook 2 | TANK binding kinase 1 | ||||||||||
Synonyms | BABL|HMGI-C|HMGIC|LIPO|SRS5|STQTL9 | FTDALS4|IIAE8|NAK|T2K | ||||||||||
Cytomap | 12q14.3 | 12q14.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | high mobility group protein HMGI-CHMGA2/KRT121P fusion | serine/threonine-protein kinase TBK1NF-kB-activating kinaseNF-kappa-B-activating kinase | ||||||||||
Modification date | 20240407 | 20240413 | ||||||||||
UniProtAcc | P52926 | Q9UHD2 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000403681, ENST00000541363, ENST00000393577, ENST00000393578, ENST00000425208, ENST00000536545, ENST00000354636, | ENST00000331710, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: HMGA2 [Title/Abstract] AND TBK1 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | HMGA2 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 14627817 |
Hgene | HMGA2 | GO:0002062 | chondrocyte differentiation | 21484705 |
Hgene | HMGA2 | GO:0006284 | base-excision repair | 19465398 |
Hgene | HMGA2 | GO:0010564 | regulation of cell cycle process | 14645522 |
Hgene | HMGA2 | GO:0010628 | positive regulation of gene expression | 18832382 |
Hgene | HMGA2 | GO:0031507 | heterochromatin formation | 16901784 |
Hgene | HMGA2 | GO:0035556 | intracellular signal transduction | 16061642 |
Hgene | HMGA2 | GO:0035988 | chondrocyte proliferation | 21484705 |
Hgene | HMGA2 | GO:0043066 | negative regulation of apoptotic process | 19465398 |
Hgene | HMGA2 | GO:0043392 | negative regulation of DNA binding | 14645522 |
Hgene | HMGA2 | GO:0043922 | negative regulation by host of viral transcription | 17005673 |
Hgene | HMGA2 | GO:0045869 | negative regulation of single stranded viral RNA replication via double stranded DNA intermediate | 17005673 |
Hgene | HMGA2 | GO:0045892 | negative regulation of DNA-templated transcription | 18832382 |
Hgene | HMGA2 | GO:0045893 | positive regulation of DNA-templated transcription | 15225648|15755872|17005673|17324944|17426251 |
Hgene | HMGA2 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 14645522|18832382 |
Hgene | HMGA2 | GO:0071902 | positive regulation of protein serine/threonine kinase activity | 19549901 |
Hgene | HMGA2 | GO:0090402 | oncogene-induced cell senescence | 16901784 |
Hgene | HMGA2 | GO:2000648 | positive regulation of stem cell proliferation | 21484705 |
Hgene | HMGA2 | GO:2001033 | negative regulation of double-strand break repair via nonhomologous end joining | 19549901 |
Tgene | TBK1 | GO:0002218 | activation of innate immune response | 25636800 |
Tgene | TBK1 | GO:0002753 | cytoplasmic pattern recognition receptor signaling pathway | 29441066 |
Tgene | TBK1 | GO:0006468 | protein phosphorylation | 27103069 |
Tgene | TBK1 | GO:0010508 | positive regulation of autophagy | 28871090 |
Tgene | TBK1 | GO:0016239 | positive regulation of macroautophagy | 27103069 |
Tgene | TBK1 | GO:0018105 | peptidyl-serine phosphorylation | 25636800|25803835|27103069 |
Tgene | TBK1 | GO:0018107 | peptidyl-threonine phosphorylation | 25636800|27103069 |
Tgene | TBK1 | GO:0032479 | regulation of type I interferon production | 25636800 |
Tgene | TBK1 | GO:0032481 | positive regulation of type I interferon production | 14703513|22394562|25636800|29441066 |
Tgene | TBK1 | GO:0032727 | positive regulation of interferon-alpha production | 16127453 |
Tgene | TBK1 | GO:0032728 | positive regulation of interferon-beta production | 16127453 |
Tgene | TBK1 | GO:0034142 | toll-like receptor 4 signaling pathway | 28747347 |
Tgene | TBK1 | GO:0045087 | innate immune response | 25636800 |
Tgene | TBK1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 16127453 |
Tgene | TBK1 | GO:0140374 | antiviral innate immune response | 14703513|22394562 |
Tgene | TBK1 | GO:1904262 | negative regulation of TORC1 signaling | 31530866 |
Tgene | TBK1 | GO:1904263 | positive regulation of TORC1 signaling | 29150432 |
Kinase Fusion gene breakpoints across HMGA2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across TBK1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
CCLE | DMS 114 | HMGA2 | chr12 | 66232349 | TBK1 | chr12 | 64860681 |
CCLE | DMS 114 | HMGA2 | chr12 | 66232349 | TBK1 | chr12 | 64868010 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000403681 | ENST00000331710 | HMGA2 | chr12 | 66232349 | TBK1 | chr12 | 64868010 | 3766 | 632 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000403681_ENST00000331710_HMGA2_chr12_66232349_TBK1_chr12_64868010_length(amino acids)=632 MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWHPDMYER AVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLL TPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLA QHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNET VHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDR NVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQC FDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVD -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr12:/chr12:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
HMGA2 | TBK1 |
FUNCTION: Functions as a transcriptional regulator. Functions in cell cycle regulation through CCNA2. Plays an important role in chromosome condensation during the meiotic G2/M transition of spermatocytes. Plays a role in postnatal myogenesis, is involved in satellite cell activation (By similarity). Positively regulates IGF2 expression through PLAG1 and in a PLAG1-independent manner (PubMed:28796236). {ECO:0000250|UniProtKB:P52927, ECO:0000269|PubMed:14645522, ECO:0000269|PubMed:28796236}. | FUNCTION: Serine/threonine kinase that plays an essential role in regulating inflammatory responses to foreign agents (PubMed:12692549, PubMed:14703513, PubMed:18583960, PubMed:12702806, PubMed:15367631, PubMed:10581243, PubMed:11839743, PubMed:15485837, PubMed:21138416, PubMed:25636800, PubMed:23453971, PubMed:23453972, PubMed:23746807, PubMed:26611359, PubMed:32404352). Following activation of toll-like receptors by viral or bacterial components, associates with TRAF3 and TANK and phosphorylates interferon regulatory factors (IRFs) IRF3 and IRF7 as well as DDX3X (PubMed:12692549, PubMed:14703513, PubMed:18583960, PubMed:12702806, PubMed:15367631, PubMed:25636800). This activity allows subsequent homodimerization and nuclear translocation of the IRFs leading to transcriptional activation of pro-inflammatory and antiviral genes including IFNA and IFNB (PubMed:12702806, PubMed:15367631, PubMed:25636800, PubMed:32972995). In order to establish such an antiviral state, TBK1 form several different complexes whose composition depends on the type of cell and cellular stimuli (PubMed:23453971, PubMed:23453972, PubMed:23746807). Plays a key role in IRF3 activation: acts by first phosphorylating innate adapter proteins MAVS, STING1 and TICAM1 on their pLxIS motif, leading to recruitment of IRF3, thereby licensing IRF3 for phosphorylation by TBK1 (PubMed:25636800, PubMed:30842653). Phosphorylated IRF3 dissociates from the adapter proteins, dimerizes, and then enters the nucleus to induce expression of interferons (PubMed:25636800). Thus, several scaffolding molecules including FADD, TRADD, MAVS, AZI2, TANK or TBKBP1/SINTBAD can be recruited to the TBK1-containing-complexes (PubMed:21931631). Under particular conditions, functions as a NF-kappa-B effector by phosphorylating NF-kappa-B inhibitor alpha/NFKBIA, IKBKB or RELA to translocate NF-Kappa-B to the nucleus (PubMed:10783893, PubMed:15489227). Restricts bacterial proliferation by phosphorylating the autophagy receptor OPTN/Optineurin on 'Ser-177', thus enhancing LC3 binding affinity and antibacterial autophagy (PubMed:21617041). Phosphorylates SMCR8 component of the C9orf72-SMCR8 complex, promoting autophagosome maturation (PubMed:27103069). Phosphorylates ATG8 proteins MAP1LC3C and GABARAPL2, thereby preventing their delipidation and premature removal from nascent autophagosomes (PubMed:31709703). Phosphorylates and activates AKT1 (PubMed:21464307). Seems to play a role in energy balance regulation by sustaining a state of chronic, low-grade inflammation in obesity, wich leads to a negative impact on insulin sensitivity (By similarity). Attenuates retroviral budding by phosphorylating the endosomal sorting complex required for transport-I (ESCRT-I) subunit VPS37C (PubMed:21270402). Phosphorylates Borna disease virus (BDV) P protein (PubMed:16155125). Plays an essential role in the TLR3- and IFN-dependent control of herpes virus HSV-1 and HSV-2 infections in the central nervous system (PubMed:22851595). Acts both as a positive and negative regulator of the mTORC1 complex, depending on the context: activates mTORC1 in response to growth factors by catalyzing phosphorylation of MTOR, while it limits the mTORC1 complex by promoting phosphorylation of RPTOR (PubMed:29150432, PubMed:31530866). {ECO:0000250|UniProtKB:Q9WUN2, ECO:0000269|PubMed:10581243, ECO:0000269|PubMed:10783893, ECO:0000269|PubMed:11839743, ECO:0000269|PubMed:12692549, ECO:0000269|PubMed:12702806, ECO:0000269|PubMed:14703513, ECO:0000269|PubMed:15367631, ECO:0000269|PubMed:15485837, ECO:0000269|PubMed:15489227, ECO:0000269|PubMed:16155125, ECO:0000269|PubMed:18583960, ECO:0000269|PubMed:21138416, ECO:0000269|PubMed:21270402, ECO:0000269|PubMed:21464307, ECO:0000269|PubMed:21617041, ECO:0000269|PubMed:21931631, ECO:0000269|PubMed:22851595, ECO:0000269|PubMed:23453971, ECO:0000269|PubMed:23453972, ECO:0000269|PubMed:23746807, ECO:0000269|PubMed:25636800, ECO:0000269|PubMed:26611359, ECO:0000269|PubMed:27103069, ECO:0000269|PubMed:29150432, ECO:0000269|PubMed:30842653, ECO:0000269|PubMed:31530866, ECO:0000269|PubMed:31709703, ECO:0000269|PubMed:32972995}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | HMGA2 | 66232349 | TBK1 | 64868010 | ENST00000403681 | 4 | 21 | 309_385 | 180 | 730 | Domain | Note=Ubiquitin-like |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>TKFP_411_HMGA2_TBK1 | ENST00000403681 | ENST00000331710 | HMGA2 | chr12 | 66232349 | TBK1 | chr12 | 64868010 | MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWHPDMYER AVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLL TPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLA QHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNET VHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDR NVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQC FDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVD | 632_HMGA2_TBK1 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
233_HMGA2_TBK1_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of HMGA2_TBK1 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
TBK1 | Q9UHD2 | human | PELI1 | Q96FA3 | T80 | DQHsIsYtLsRAQtV | Pellino |
TBK1 | Q9UHD2 | human | SQSTM1 | Q13501 | S403 | ESLSQMLsMGFsDEG | UBA_5 |
TBK1 | Q9UHD2 | human | PRPS1 | P60891 | T228 | DMADtCGtICHAADk | Pribosyl_synth |
TBK1 | Q9UHD2 | human | LMO7 | Q8WWI1-3 | S417 | KWKDRRKsYTSDLQK | DUF4757 |
TBK1 | Q9UHD2 | human | OPTN | Q96CV9 | S177 | ssGssEDsFVEIRMA | |
TBK1 | Q9UHD2 | human | GABARAPL2 | P60520 | S88 | DKTVPQssLTMGQLY | ATG8 |
TBK1 | Q9UHD2 | human | DDAH2 | O95865 | S253 | QEALQKLsDVTLVPV | |
TBK1 | Q9UHD2 | human | TNIP1 | Q15025 | S123 | PPSSGTssEFEVVTP | |
TBK1 | Q9UHD2 | human | TRIP12 | Q14669 | S312 | STKkRsEsPPAELPs | |
TBK1 | Q9UHD2 | human | RPS6KB1 | P23443 | S447 | GsPRtPVsPVkFsPG | |
TBK1 | Q9UHD2 | human | ASB8 | Q9H765 | S17 | QSIQSKYsLSERLIR | |
TBK1 | Q9UHD2 | human | OPTN | Q96CV9 | S473 | AQMEVYCsDFHAERA | CC2-LZ |
TBK1 | Q9UHD2 | human | SMCR8 | Q8TEV9 | T796 | AsPAGAGtLHALSRY | |
TBK1 | Q9UHD2 | human | GABARAPL2 | P60520 | S87 | VDKTVPQssLTMGQL | ATG8 |
TBK1 | Q9UHD2 | human | STING1 | Q86WV6 | S366 | QEPELLIsGMEkPLP | |
TBK1 | Q9UHD2 | human | MAPT | P10636-8 | S198 | sGDRsGyssPGsPGt | |
TBK1 | Q9UHD2 | human | IRF3 | Q14653 | T404 | NsHPLsLtsDQYKAY | |
TBK1 | Q9UHD2 | human | IRF3 | Q14653 | S386 | ARVGGAssLENtVDL | |
TBK1 | Q9UHD2 | human | MAP1LC3C | Q9BXW4 | S96 | VNNKsLVsMSATMAE | ATG8 |
TBK1 | Q9UHD2 | human | DDAH2 | O95865 | T203 | VRAMAVLtDHPyASL | |
TBK1 | Q9UHD2 | human | E2F1 | Q01094 | S332 | TDSATIVsPPPSsPP | |
TBK1 | Q9UHD2 | human | PELI1 | Q96FA3 | T288 | QCPVGFNtLAFPsMk | Pellino |
TBK1 | Q9UHD2 | human | MAPT | P10636-8 | S214 | GsRsRtPsLPtPPtR | |
TBK1 | Q9UHD2 | human | HTT | P42858 | S13 | kLMkAFEsLksFQQQ | |
TBK1 | Q9UHD2 | human | IRF7 | Q92985 | S477 | VssLDSSsLsLCLsS | |
TBK1 | Q9UHD2 | human | IRF3 | Q14653 | S396 | NtVDLHIsNsHPLsL | |
TBK1 | Q9UHD2 | human | MAPT | P10636-8 | S356 | rVQskIGsLDNItHV | Tubulin-binding |
TBK1 | Q9UHD2 | human | MAPT | P10636-8 | S285 | INkkLDLsNVQskCG | Tubulin-binding |
TBK1 | Q9UHD2 | human | IRF7 | Q92985 | S471 | GTQREGVssLDSSsL | |
TBK1 | Q9UHD2 | human | SIKE1 | Q9BRV8 | S185 | kELRELLsIssEsLQ | SIKE |
TBK1 | Q9UHD2 | human | DDAH2 | O95865 | S245 | GGGDLPNsQEALQKL | |
TBK1 | Q9UHD2 | human | AKT1 | P31749 | S473 | RPHFPQFsysAsGtA | Pkinase_C |
TBK1 | Q9UHD2 | human | TRIM56 | Q9BRZ2 | T442 | LEEDRAQtPHEDGGP | |
TBK1 | Q9UHD2 | human | STAT6 | P42226 | S407 | PIQLQALsLPLVVIV | STAT_bind |
TBK1 | Q9UHD2 | human | PRPS2 | P11908 | T228 | DMADtCGtICHAADk | Pribosyl_synth |
TBK1 | Q9UHD2 | human | STX17 | P56962 | S202 | SQQEKIDsIADHVNS | SNARE |
TBK1 | Q9UHD2 | human | MTOR | P42345 | S2159 | RIQsIAPsLQVItSk | |
TBK1 | Q9UHD2 | human | MAPT | P10636-8 | T30 | RKDQGGytMHQDQEG | |
TBK1 | Q9UHD2 | human | TBK1 | Q9UHD2 | S172 | EDDEQFVsLyGTEEy | Pkinase |
TBK1 | Q9UHD2 | human | IRF7 | Q92985 | S472 | TQREGVssLDSSsLs | |
TBK1 | Q9UHD2 | human | RPTOR | Q8N122 | S877 | HIHQAGGsPPAssts | |
TBK1 | Q9UHD2 | human | SMCR8 | Q8TEV9 | S402 | QDRPPsSsLEECPIP | |
TBK1 | Q9UHD2 | human | SIKE1 | Q9BRV8 | S198 | LQARkENsMDTASQA | |
TBK1 | Q9UHD2 | human | RPS6KB1 | P23443 | T444 | RFIGsPRtPVsPVkF | |
TBK1 | Q9UHD2 | human | IRF3 | Q14653 | S398 | VDLHIsNsHPLsLts | |
TBK1 | Q9UHD2 | human | IRF5 | Q13568 | S293 | VELFGPIsLEQVRFP | IRF-3 |
TBK1 | Q9UHD2 | human | MAPT | P10636-8 | S324 | kVTskCGsLGNIHHk | Tubulin-binding |
TBK1 | Q9UHD2 | human | MAPT | P10636-8 | S289 | LDLsNVQskCGsKDN | Tubulin-binding |
TBK1 | Q9UHD2 | human | HDAC3 | O15379 | S424 | DHDNDKEsDVEI___ | |
TBK1 | Q9UHD2 | human | PELI1 | Q96FA3 | S293 | FNtLAFPsMkRkDVV | Pellino |
TBK1 | Q9UHD2 | human | SIKE1 | Q9BRV8 | S188 | RELLsIssEsLQARk | |
TBK1 | Q9UHD2 | human | XIAP | P98170 | S430 | QDESSQtsLQkEIst | |
TBK1 | Q9UHD2 | human | TICAM1 | Q8IUC6 | S210 | LAsNLEIsQsPTMPF | |
TBK1 | Q9UHD2 | human | SIKE1 | Q9BRV8 | S133 | PVLkAHQsHSAEIES | SIKE |
TBK1 | Q9UHD2 | human | PBXIP1 | Q96AQ6 | S147 | REEGRCsssDDDtDV | |
TBK1 | Q9UHD2 | human | RELA | Q04206 | S536 | sGDEDFSsIADMDFS | |
TBK1 | Q9UHD2 | human | METTL3 | Q86U44 | S67 | GPKPSTAsAVPELAT | |
TBK1 | Q9UHD2 | human | CTNNB1 | P35222 | S552 | QDtQRRtsMGGtQQQ | |
TBK1 | Q9UHD2 | human | MAVS | Q7Z434 | S442 | CFEDLAIsASTSLGM | |
TBK1 | Q9UHD2 | human | MAPT | P10636-8 | S191 | ssGEPPKsGDRsGys | |
TBK1 | Q9UHD2 | human | IRF7 | Q92985 | S479 | sLDSSsLsLCLsSAN | |
TBK1 | Q9UHD2 | human | PELI1 | Q96FA3 | S76 | IsNKDQHsIsYtLsR | Pellino |
TBK1 | Q9UHD2 | human | HTT | P42858 | S16 | kAFEsLksFQQQQQQ | |
TBK1 | Q9UHD2 | human | IRF3 | Q14653 | S402 | IsNsHPLsLtsDQYK | |
TBK1 | Q9UHD2 | human | OPTN | Q96CV9 | S513 | FEDGGRQsLMEMQsR | |
TBK1 | Q9UHD2 | human | MAP1LC3C | Q9BXW4 | S93 | YLLVNNKsLVsMSAT | ATG8 |
TBK1 | Q9UHD2 | human | IRF3 | Q14653 | S385 | MARVGGAssLENtVD | |
TBK1 | Q9UHD2 | human | PEBP1 | P30086 | S109 | VLsDyVGsGPPkGTG | PBP |
TBK1 | Q9UHD2 | human | IRF3 | Q14653 | S175 | PQPLRsPsLDNPtPF | |
TBK1 | Q9UHD2 | human | STAT2 | P52630 | T404 | IWDFGYLtLVEQRSG | STAT_bind |
TBK1 | Q9UHD2 | human | ESR1 | P03372 | S305 | IkRSkkNsLALSLtA | |
TBK1 | Q9UHD2 | human | STING1 | Q86WV6 | S358 | VPStstMsQEPELLI | |
TBK1 | Q9UHD2 | human | IRF3 | Q14653 | S173 | PCPQPLRsPsLDNPt | |
TBK1 | Q9UHD2 | human | TNIP1 | Q15025 | S122 | KPPSSGTssEFEVVT | |
TBK1 | Q9UHD2 | human | SIKE1 | Q9BRV8 | S187 | LRELLsIssEsLQAR | SIKE |
TBK1 | Q9UHD2 | human | SQSTM1 | Q13501 | S366 | PEsEGPssLDPsQEG | |
TBK1 | Q9UHD2 | human | SIKE1 | Q9BRV8 | S190 | LLsIssEsLQARkEN | |
TBK1 | Q9UHD2 | human | IRF5 | Q13568 | S158 | QRMLPSLsLTEDVKW | |
TBK1 | Q9UHD2 | human | MAPT | P10636-8 | S305 | kHVPGGGsVQIVykP | Tubulin-binding |
TBK1 | Q9UHD2 | human | IRF3 | Q14653 | S405 | sHPLsLtsDQYKAYL | |
TBK1 | Q9UHD2 | human | AKT1 | P31749 | T308 | kDGAtMKtFCGtPEy | Pkinase |
TBK1 | Q9UHD2 | human | DDAH2 | O95865 | T211 | DHPyASLtLPDDAAA |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
TBK1 | ID | Description | 0.00e+00 |
TBK1 | GO:0045088 | regulation of innate immune response | 4.50e-12 |
TBK1 | GO:0032728 | positive regulation of interferon-beta production | 9.51e-12 |
TBK1 | GO:0007249 | canonical NF-kappaB signal transduction | 9.51e-12 |
TBK1 | GO:0032481 | positive regulation of type I interferon production | 9.51e-12 |
TBK1 | GO:0060338 | regulation of type I interferon-mediated signaling pathway | 1.00e-11 |
TBK1 | GO:0043122 | regulation of canonical NF-kappaB signal transduction | 4.11e-11 |
TBK1 | GO:0032608 | interferon-beta production | 7.66e-11 |
TBK1 | GO:0032648 | regulation of interferon-beta production | 7.66e-11 |
TBK1 | GO:0002221 | pattern recognition receptor signaling pathway | 2.44e-10 |
TBK1 | GO:0060340 | positive regulation of type I interferon-mediated signaling pathway | 3.81e-10 |
TBK1 | GO:0002758 | innate immune response-activating signaling pathway | 3.90e-10 |
TBK1 | GO:0045089 | positive regulation of innate immune response | 3.90e-10 |
TBK1 | GO:0032479 | regulation of type I interferon production | 3.90e-10 |
TBK1 | GO:0032606 | type I interferon production | 3.90e-10 |
TBK1 | GO:0060337 | type I interferon-mediated signaling pathway | 6.35e-10 |
TBK1 | GO:0071357 | cellular response to type I interferon | 6.57e-10 |
TBK1 | GO:0002218 | activation of innate immune response | 6.81e-10 |
TBK1 | GO:0002833 | positive regulation of response to biotic stimulus | 6.81e-10 |
TBK1 | GO:0031349 | positive regulation of defense response | 7.16e-10 |
TBK1 | GO:0034340 | response to type I interferon | 9.34e-10 |
TBK1 | GO:0002753 | cytosolic pattern recognition receptor signaling pathway | 1.24e-09 |
TBK1 | GO:0140888 | interferon-mediated signaling pathway | 3.71e-09 |
TBK1 | GO:0016236 | macroautophagy | 3.71e-09 |
TBK1 | GO:0001959 | regulation of cytokine-mediated signaling pathway | 4.49e-09 |
TBK1 | GO:0010506 | regulation of autophagy | 7.22e-09 |
TBK1 | GO:0060759 | regulation of response to cytokine stimulus | 7.61e-09 |
TBK1 | GO:0051607 | defense response to virus | 7.53e-08 |
TBK1 | GO:0140546 | defense response to symbiont | 7.53e-08 |
TBK1 | GO:0032727 | positive regulation of interferon-alpha production | 7.93e-08 |
TBK1 | GO:1903320 | regulation of protein modification by small protein conjugation or removal | 8.16e-08 |
TBK1 | GO:0030522 | intracellular receptor signaling pathway | 1.13e-07 |
TBK1 | GO:0002757 | immune response-activating signaling pathway | 1.17e-07 |
TBK1 | GO:0001961 | positive regulation of cytokine-mediated signaling pathway | 1.40e-07 |
TBK1 | GO:0001819 | positive regulation of cytokine production | 1.91e-07 |
TBK1 | GO:0002764 | immune response-regulating signaling pathway | 1.91e-07 |
TBK1 | GO:0032607 | interferon-alpha production | 2.06e-07 |
TBK1 | GO:0032647 | regulation of interferon-alpha production | 2.06e-07 |
TBK1 | GO:0060760 | positive regulation of response to cytokine stimulus | 2.40e-07 |
TBK1 | GO:1901873 | regulation of post-translational protein modification | 2.46e-07 |
TBK1 | GO:0031331 | positive regulation of cellular catabolic process | 2.58e-07 |
TBK1 | GO:0043123 | positive regulation of canonical NF-kappaB signal transduction | 2.58e-07 |
TBK1 | GO:0032008 | positive regulation of TOR signaling | 2.60e-07 |
TBK1 | GO:0009615 | response to virus | 6.12e-07 |
TBK1 | GO:0010508 | positive regulation of autophagy | 9.48e-07 |
TBK1 | GO:0016241 | regulation of macroautophagy | 1.39e-06 |
TBK1 | GO:0061912 | selective autophagy | 1.77e-06 |
TBK1 | GO:0031929 | TOR signaling | 1.86e-06 |
TBK1 | GO:0038202 | TORC1 signaling | 2.04e-06 |
TBK1 | GO:0043331 | response to dsRNA | 4.40e-06 |
Top |
Related Drugs to HMGA2_TBK1 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning HMGA2-TBK1 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to HMGA2_TBK1 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | HMGA2 | C1519176 | Salivary Gland Pleomorphic Adenoma | 2 | ORPHANET |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |