| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Kinase Fusion Gene:HNRNPUL1_BRSK1 |
Kinase Fusion Protein Summary |
 Kinase Fusion gene summary |
| Kinase Fusion partner gene information | Kinase Fusion gene name: HNRNPUL1_BRSK1 | KinaseFusionDB ID: KFG2739 | FusionGDB2.0 ID: KFG2739 | Hgene | Tgene | Gene symbol | HNRNPUL1 | BRSK1 | Gene ID | 11100 | 84446 | |
| Gene name | heterogeneous nuclear ribonucleoprotein U like 1 | BR serine/threonine kinase 1 | ||||||||||
| Synonyms | E1B-AP5|E1BAP5|HNRPUL1 | SAD-B|hSAD1 | ||||||||||
| Cytomap | 19q13.2 | 19q13.42 | ||||||||||
| Type of gene | protein-coding | protein-coding | ||||||||||
| Description | heterogeneous nuclear ribonucleoprotein U-like protein 1E1B 55kDa associated protein 5E1B-55 kDa-associated protein 5adenovirus early region 1B-associated protein 5 | serine/threonine-protein kinase BRSK1BR serine/threonine-protein kinase 1SAD1 homologSAD1 kinasebrain-selective kinase 1brain-specific serine/threonine-protein kinase 1protein kinase SAD1Aserine/threonine-protein kinase SAD-Bsynapses of Amphids De | ||||||||||
| Modification date | 20240407 | 20240407 | ||||||||||
| UniProtAcc | Q9BUJ2 | Q8TDC3 | ||||||||||
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000263367, ENST00000352456, ENST00000392006, ENST00000593587, ENST00000595018, ENST00000602130, ENST00000378215, ENST00000594207, | ENST00000326848, ENST00000588584, ENST00000309383, ENST00000585418, ENST00000590333, | |||||||||
| Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: HNRNPUL1 [Title/Abstract] AND BRSK1 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | HNRNPUL1(41787180)-BRSK1(55795889), # samples:1 | |||||||||||
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | BRSK1 | GO:0000086 | G2/M transition of mitotic cell cycle | 15150265 |
| Tgene | BRSK1 | GO:0006468 | protein phosphorylation | 15150265 |
| Tgene | BRSK1 | GO:0006974 | DNA damage response | 15150265 |
| Tgene | BRSK1 | GO:0007095 | mitotic G2 DNA damage checkpoint signaling | 15150265 |
| Tgene | BRSK1 | GO:0009411 | response to UV | 15150265 |
| Tgene | BRSK1 | GO:0009411 | response to UV | 15150265 |
| Tgene | BRSK1 | GO:0010212 | response to ionizing radiation | 15150265 |
| Tgene | BRSK1 | GO:0018105 | peptidyl-serine phosphorylation | 15150265 |
| Kinase Fusion gene breakpoints across HNRNPUL1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Kinase Fusion gene breakpoints across BRSK1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Kinase Fusion Gene Sample Information |
| Kinase Fusion gene information. |
| Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
| ChimerDB4 | TCGA-C5-A907-01A | HNRNPUL1 | chr19 | 41787180 | BRSK1 | chr19 | 55795889 |
Top |
Kinase Fusion ORF Analysis |
| Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
| ENST00000352456 | ENST00000590333 | HNRNPUL1 | chr19 | 41787180 | BRSK1 | chr19 | 55795889 | 3515 | 1012 |
Top |
Kinase Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000352456_ENST00000590333_HNRNPUL1_chr19_41787180_BRSK1_chr19_55795889_length(amino acids)=1012 MGGERERGSRTWARGGVSGLEPLGPHAMDNITRQNQFYDTQVIKQENESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKP DRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVR RGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFAHAQYVGPYRL EKTLGKGQTGLVKLGVHCITGQKVAIKIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKG RLTPKEARKFFRQIVSALDFCHSYSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCGSPHYACPEVIKGEKYDGRRADMWS CGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPGRRVAM RSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKERYPSCEDQDLPPRNDVDPPRKRVDSPMLSRHGKRRPE RKSMEVLSITDAGGGGSPVPTRRALEMAQHSQRSRSVSGASTGLSSSPLSSPRSPVFSFSPEPGAGDEARGGGSPTSKTQTLPSRGPRGG GAGEQPPPPSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGAAWRSRLNSIRNSFLGSPRFHRRKMQVPTA EEMSSLTPESSPELAKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVD ISSSEGPEPSPRRDGSGGGGIYSVTFTLISGPSRRFKRVVETIQAQLLSTHDQPSVQALADEKNGAQTRPAGAPPRSLQPPPGRPDPELS -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:41787180/chr19:55795889) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| HNRNPUL1 | BRSK1 |
| FUNCTION: Acts as a basic transcriptional regulator. Represses basic transcription driven by several virus and cellular promoters. When associated with BRD7, activates transcription of glucocorticoid-responsive promoter in the absence of ligand-stimulation. Also plays a role in mRNA processing and transport. Binds avidly to poly(G) and poly(C) RNA homopolymers in vitro. {ECO:0000269|PubMed:12489984, ECO:0000269|PubMed:9733834}. | FUNCTION: Serine/threonine-protein kinase that plays a key role in polarization of neurons and centrosome duplication. Phosphorylates CDC25B, CDC25C, MAPT/TAU, RIMS1, TUBG1, TUBG2 and WEE1. Following phosphorylation and activation by STK11/LKB1, acts as a key regulator of polarization of cortical neurons, probably by mediating phosphorylation of microtubule-associated proteins such as MAPT/TAU at 'Thr-529' and 'Ser-579'. Also regulates neuron polarization by mediating phosphorylation of WEE1 at 'Ser-642' in postmitotic neurons, leading to down-regulate WEE1 activity in polarized neurons. In neurons, localizes to synaptic vesicles and plays a role in neurotransmitter release, possibly by phosphorylating RIMS1. Also acts as a positive regulator of centrosome duplication by mediating phosphorylation of gamma-tubulin (TUBG1 and TUBG2) at 'Ser-131', leading to translocation of gamma-tubulin and its associated proteins to the centrosome. Involved in the UV-induced DNA damage checkpoint response, probably by inhibiting CDK1 activity through phosphorylation and activation of WEE1, and inhibition of CDC25B and CDC25C. {ECO:0000269|PubMed:14976552, ECO:0000269|PubMed:15150265, ECO:0000269|PubMed:20026642, ECO:0000269|PubMed:21985311}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
| - Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
| Tgene | HNRNPUL1 | 41787180 | BRSK1 | 55795889 | ENST00000352456 | 0 | 10 | 34_285 | 0 | 344 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Tgene | HNRNPUL1 | 41787180 | BRSK1 | 55795889 | ENST00000352456 | 0 | 19 | 34_285 | 0 | 779 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
| Tgene | HNRNPUL1 | 41787180 | BRSK1 | 55795889 | ENST00000352456 | 0 | 10 | 314_356 | 0 | 344 | Domain | Note=UBA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00212 |
| Tgene | HNRNPUL1 | 41787180 | BRSK1 | 55795889 | ENST00000352456 | 0 | 19 | 314_356 | 0 | 779 | Domain | Note=UBA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00212 |
| Tgene | HNRNPUL1 | 41787180 | BRSK1 | 55795889 | ENST00000352456 | 1 | 21 | 314_356 | 42 | 795 | Domain | Note=UBA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00212 |
Top |
Kinase Fusion Protein Structures |
| CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
| PDB file >>>TKFP_415_HNRNPUL1_BRSK1 | ENST00000352456 | ENST00000590333 | HNRNPUL1 | chr19 | 41787180 | BRSK1 | chr19 | 55795889 | MGGERERGSRTWARGGVSGLEPLGPHAMDNITRQNQFYDTQVIKQENESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKP DRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVR RGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFAHAQYVGPYRL EKTLGKGQTGLVKLGVHCITGQKVAIKIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKG RLTPKEARKFFRQIVSALDFCHSYSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCGSPHYACPEVIKGEKYDGRRADMWS CGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPGRRVAM RSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKERYPSCEDQDLPPRNDVDPPRKRVDSPMLSRHGKRRPE RKSMEVLSITDAGGGGSPVPTRRALEMAQHSQRSRSVSGASTGLSSSPLSSPRSPVFSFSPEPGAGDEARGGGSPTSKTQTLPSRGPRGG GAGEQPPPPSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGAAWRSRLNSIRNSFLGSPRFHRRKMQVPTA EEMSSLTPESSPELAKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVD ISSSEGPEPSPRRDGSGGGGIYSVTFTLISGPSRRFKRVVETIQAQLLSTHDQPSVQALADEKNGAQTRPAGAPPRSLQPPPGRPDPELS | 1012_HNRNPUL1_BRSK1 |
Top |
Comparison of Fusion Protein Isoforms |
| Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
| Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
| pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
Top |
Potential Active Site Information |
| The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
| Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| 236_HNRNPUL1_BRSK1_ramachandran.png |
 |
Top |
Virtual Screening Results |
| Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
| 5'-kinase fusion protein case |
| 3'-kinase fusion protein case |
Top |
| Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
| Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of HNRNPUL1_BRSK1 |
| Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
| Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
| BRSK1 | Q8TDC3 | human | MAPT | P10636-8 | S262 | NVKskIGstENLkHQ | Tubulin-binding |
| BRSK1 | Q8TDC3 | human | TUBG1 | P23258 | S385 | MANHTSIsSLFERTC | Tubulin_C |
| BRSK1 | Q8TDC3 | human | MAPT | P10636-8 | S356 | rVQskIGsLDNItHV | Tubulin-binding |
| BRSK1 | Q8TDC3 | human | TUBG1 | P23258 | S131 | READGsDsLEGFVLC | Tubulin |
| BRSK1 | Q8TDC3-2 | human | PRKAA1 | Q13131 | T183 | sDGEFLRtsCGsPNy | Pkinase |
| BRSK1 | Q8TDC3-2 | human | CDC25B | P30305 | S375 | ARVLRsksLCHDEIE | M-inducer_phosp |
| BRSK1 | Q8TDC3-2 | human | CDC25C | P30307 | S216 | sGLyRsPsMPENLNR | M-inducer_phosp |
| BRSK1 | Q8TDC3-2 | human | BRSK1 | Q8TDC3-2 | T205 | VGDSLLEtSCGsPHY | Pkinase |
| BRSK1 | Q8TDC3-2 | human | WEE1 | P30291 | S642 | KKMNRSVsLtIy___ | |
| BRSK1 | Q8TDC3-2 | human | TUBG1 | P23258 | S131 | READGsDsLEGFVLC | Tubulin |
| BRSK1 | Q8TDC3-2 | human | BRSK1 | Q8TDC3-2 | S209 | LLEtSCGsPHYACPE | Pkinase |
| Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
| Enriched GO biological processes of the phosphorylation target genes of the kinase |
| Kinase | GOID | GO term | P.adjust |
| BRSK1 | ID | Description | 0.00e+00 |
| BRSK1 | GO:0000086 | G2/M transition of mitotic cell cycle | 3.56e-05 |
| BRSK1 | GO:0044839 | cell cycle G2/M phase transition | 3.56e-05 |
| BRSK1 | GO:1901990 | regulation of mitotic cell cycle phase transition | 5.31e-04 |
| BRSK1 | GO:1901993 | regulation of meiotic cell cycle phase transition | 5.31e-04 |
| BRSK1 | GO:0010389 | regulation of G2/M transition of mitotic cell cycle | 5.31e-04 |
| BRSK1 | GO:1902749 | regulation of cell cycle G2/M phase transition | 6.15e-04 |
| BRSK1 | GO:0044771 | meiotic cell cycle phase transition | 6.22e-04 |
| BRSK1 | GO:1901987 | regulation of cell cycle phase transition | 6.59e-04 |
| BRSK1 | GO:0044772 | mitotic cell cycle phase transition | 6.60e-04 |
| BRSK1 | GO:0048285 | organelle fission | 6.89e-04 |
| BRSK1 | GO:0090043 | regulation of tubulin deacetylation | 1.06e-03 |
| BRSK1 | GO:0090042 | tubulin deacetylation | 1.17e-03 |
| BRSK1 | GO:0051446 | positive regulation of meiotic cell cycle | 1.50e-03 |
| BRSK1 | GO:0010971 | positive regulation of G2/M transition of mitotic cell cycle | 1.54e-03 |
| BRSK1 | GO:1903046 | meiotic cell cycle process | 1.54e-03 |
| BRSK1 | GO:0034063 | stress granule assembly | 1.62e-03 |
| BRSK1 | GO:1902751 | positive regulation of cell cycle G2/M phase transition | 1.62e-03 |
| BRSK1 | GO:0090311 | regulation of protein deacetylation | 1.84e-03 |
| BRSK1 | GO:0051321 | meiotic cell cycle | 2.91e-03 |
| BRSK1 | GO:1903747 | regulation of establishment of protein localization to mitochondrion | 3.53e-03 |
| BRSK1 | GO:0006476 | protein deacetylation | 4.30e-03 |
| BRSK1 | GO:0031122 | cytoplasmic microtubule organization | 4.30e-03 |
| BRSK1 | GO:0051445 | regulation of meiotic cell cycle | 5.09e-03 |
| BRSK1 | GO:0035601 | protein deacylation | 5.09e-03 |
| BRSK1 | GO:0098732 | macromolecule deacylation | 5.34e-03 |
| BRSK1 | GO:0000280 | nuclear division | 7.46e-03 |
| BRSK1 | GO:2000243 | positive regulation of reproductive process | 7.46e-03 |
| BRSK1 | GO:0046785 | microtubule polymerization | 8.59e-03 |
| BRSK1 | GO:1901992 | positive regulation of mitotic cell cycle phase transition | 9.01e-03 |
| BRSK1 | GO:0006473 | protein acetylation | 1.02e-02 |
| BRSK1 | GO:1901989 | positive regulation of cell cycle phase transition | 1.24e-02 |
| BRSK1 | GO:0072655 | establishment of protein localization to mitochondrion | 1.30e-02 |
| BRSK1 | GO:0045931 | positive regulation of mitotic cell cycle | 1.35e-02 |
| BRSK1 | GO:0070585 | protein localization to mitochondrion | 1.37e-02 |
| BRSK1 | GO:0031109 | microtubule polymerization or depolymerization | 1.39e-02 |
| BRSK1 | GO:0061982 | meiosis I cell cycle process | 1.39e-02 |
| BRSK1 | GO:0045834 | positive regulation of lipid metabolic process | 1.54e-02 |
| BRSK1 | GO:0043543 | protein acylation | 1.54e-02 |
| BRSK1 | GO:0009411 | response to UV | 1.59e-02 |
| BRSK1 | GO:0034614 | cellular response to reactive oxygen species | 1.59e-02 |
| BRSK1 | GO:0030010 | establishment of cell polarity | 1.59e-02 |
| BRSK1 | GO:0050770 | regulation of axonogenesis | 1.59e-02 |
| BRSK1 | GO:0070507 | regulation of microtubule cytoskeleton organization | 1.63e-02 |
| BRSK1 | GO:0009266 | response to temperature stimulus | 1.79e-02 |
| BRSK1 | GO:1901991 | negative regulation of mitotic cell cycle phase transition | 2.29e-02 |
| BRSK1 | GO:0000302 | response to reactive oxygen species | 2.45e-02 |
| BRSK1 | GO:2000241 | regulation of reproductive process | 2.45e-02 |
| BRSK1 | GO:0019722 | calcium-mediated signaling | 2.46e-02 |
| BRSK1 | GO:0048167 | regulation of synaptic plasticity | 2.50e-02 |
Top |
Related Drugs to HNRNPUL1_BRSK1 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
| Distribution of the number of studies mentioning HNRNPUL1-BRSK1 and kinase inhibitors the PubMed Abstract (04-01-2024) |
| Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to HNRNPUL1_BRSK1 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
| MeSH ID | MeSH term |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
| Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
| Clinical Trials from clinicaltrials.gov (06-17-2024) |
| Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |
Copyright 2024-Present -The University of Texas Health Science Center at Houston
Web File Viewing | Emergency Information |Campus Carry|Site Policies |