UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:JAK2_PAX5 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: JAK2_PAX5 | KinaseFusionDB ID: KFG2952 | FusionGDB2.0 ID: KFG2952 | Hgene | Tgene | Gene symbol | JAK2 | PAX5 | Gene ID | 3717 | 5079 | |
Gene name | Janus kinase 2 | paired box 5 | ||||||||||
Synonyms | JTK10 | ALL3|BSAP|PAX-5 | ||||||||||
Cytomap | 9p24.1 | 9p13.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | tyrosine-protein kinase JAK2JAK-2Janus kinase 2 (a protein tyrosine kinase) | paired box protein Pax-5B-cell lineage specific activatorpaired box homeotic gene 5paired domain gene 5transcription factor PAX 5 | ||||||||||
Modification date | 20240411 | 20240407 | ||||||||||
UniProtAcc | O60674 | Q02548 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000381652, ENST00000539801, ENST00000544510, ENST00000487310, | ENST00000358127, ENST00000377847, ENST00000377852, ENST00000377853, ENST00000414447, ENST00000446742, ENST00000520154, ENST00000520281, ENST00000522003, ENST00000523145, ENST00000523241, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: JAK2 [Title/Abstract] AND PAX5 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | JAK2 | GO:0007259 | cell surface receptor signaling pathway via JAK-STAT | 18692472|31145836 |
Hgene | JAK2 | GO:0010572 | positive regulation of platelet activation | 31145836 |
Hgene | JAK2 | GO:0010811 | positive regulation of cell-substrate adhesion | 10925297 |
Hgene | JAK2 | GO:0019221 | cytokine-mediated signaling pathway | 8609418 |
Hgene | JAK2 | GO:0032729 | positive regulation of type II interferon production | 12023369|19088061 |
Hgene | JAK2 | GO:0032819 | positive regulation of natural killer cell proliferation | 19088061 |
Hgene | JAK2 | GO:0033209 | tumor necrosis factor-mediated signaling pathway | 8609418 |
Hgene | JAK2 | GO:0034612 | response to tumor necrosis factor | 8609418 |
Hgene | JAK2 | GO:0035722 | interleukin-12-mediated signaling pathway | 7528775 |
Hgene | JAK2 | GO:0038043 | interleukin-5-mediated signaling pathway | 7613138 |
Hgene | JAK2 | GO:0038156 | interleukin-3-mediated signaling pathway | 8007942 |
Hgene | JAK2 | GO:0038157 | granulocyte-macrophage colony-stimulating factor signaling pathway | 18692472 |
Hgene | JAK2 | GO:0042102 | positive regulation of T cell proliferation | 11114383 |
Hgene | JAK2 | GO:0043687 | post-translational protein modification | 19783980 |
Hgene | JAK2 | GO:0046427 | positive regulation of receptor signaling pathway via JAK-STAT | 7638186|12023369 |
Hgene | JAK2 | GO:0046677 | response to antibiotic | 16280321 |
Hgene | JAK2 | GO:0050727 | regulation of inflammatory response | 10925297 |
Hgene | JAK2 | GO:0051142 | positive regulation of NK T cell proliferation | 19088061 |
Hgene | JAK2 | GO:0060396 | growth hormone receptor signaling pathway | 10925297 |
Hgene | JAK2 | GO:0070665 | positive regulation of leukocyte proliferation | 18692472 |
Hgene | JAK2 | GO:0070671 | response to interleukin-12 | 7528775 |
Hgene | JAK2 | GO:1901731 | positive regulation of platelet aggregation | 31145836 |
Kinase Fusion gene breakpoints across JAK2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across PAX5 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerKB3 | . | JAK2 | chr9 | 5080683 | PAX5 | chr9 | 36966721 |
COSMIC | 1510796 | JAK2 | chr9 | 5080682 | PAX5 | chr9 | 36966721 |
COSMIC | 1510797 | JAK2 | chr9 | 5080682 | PAX5 | chr9 | 36966721 |
COSMIC | 1510798 | JAK2 | chr9 | 5080682 | PAX5 | chr9 | 36966721 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000539801 | ENST00000358127 | JAK2 | chr9 | 5080682 | PAX5 | chr9 | 36966721 | 10404 | 1001 |
ENST00000539801 | ENST00000358127 | JAK2 | chr9 | 5080683 | PAX5 | chr9 | 36966721 | 10404 | 1001 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000539801_ENST00000358127_JAK2_chr9_5080682_PAX5_chr9_36966721_length(amino acids)=1001 MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSGEYVAEEICIAASKACGITPVYHNMFALMSE TERIWYPPNHVFHIDESTRHNVLYRIRFYFPRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKF EVKEPGSGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYK HCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVK FGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFT PGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIG SSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAA -------------------------------------------------------------- >ENST00000539801_ENST00000358127_JAK2_chr9_5080683_PAX5_chr9_36966721_length(amino acids)=1001 MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSGEYVAEEICIAASKACGITPVYHNMFALMSE TERIWYPPNHVFHIDESTRHNVLYRIRFYFPRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKF EVKEPGSGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYK HCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVK FGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFT PGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIG SSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAA -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:/chr9:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
JAK2 | PAX5 |
FUNCTION: Non-receptor tyrosine kinase involved in various processes such as cell growth, development, differentiation or histone modifications. Mediates essential signaling events in both innate and adaptive immunity. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors such as growth hormone (GHR), prolactin (PRLR), leptin (LEPR), erythropoietin (EPOR), thrombopoietin (THPO); or type II receptors including IFN-alpha, IFN-beta, IFN-gamma and multiple interleukins (PubMed:7615558). Following ligand-binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins (PubMed:9618263). Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, cell stimulation with erythropoietin (EPO) during erythropoiesis leads to JAK2 autophosphorylation, activation, and its association with erythropoietin receptor (EPOR) that becomes phosphorylated in its cytoplasmic domain. Then, STAT5 (STAT5A or STAT5B) is recruited, phosphorylated and activated by JAK2. Once activated, dimerized STAT5 translocates into the nucleus and promotes the transcription of several essential genes involved in the modulation of erythropoiesis. Part of a signaling cascade that is activated by increased cellular retinol and that leads to the activation of STAT5 (STAT5A or STAT5B) (PubMed:21368206). In addition, JAK2 mediates angiotensin-2-induced ARHGEF1 phosphorylation (PubMed:20098430). Plays a role in cell cycle by phosphorylating CDKN1B (PubMed:21423214). Cooperates with TEC through reciprocal phosphorylation to mediate cytokine-driven activation of FOS transcription. In the nucleus, plays a key role in chromatin by specifically mediating phosphorylation of 'Tyr-41' of histone H3 (H3Y41ph), a specific tag that promotes exclusion of CBX5 (HP1 alpha) from chromatin (PubMed:19783980). {ECO:0000269|PubMed:12023369, ECO:0000269|PubMed:19783980, ECO:0000269|PubMed:20098430, ECO:0000269|PubMed:21368206, ECO:0000269|PubMed:21423214, ECO:0000269|PubMed:7615558, ECO:0000269|PubMed:9618263}. | FUNCTION: Transcription factor that plays an essential role in commitment of lymphoid progenitors to the B-lymphocyte lineage (PubMed:10811620, PubMed:27181361). Fulfills a dual role by repressing B-lineage inappropriate genes and simultaneously activating B-lineage-specific genes (PubMed:10811620, PubMed:27181361). In turn, regulates cell adhesion and migration, induces V(H)-to-D(H)J(H) recombination, facilitates pre-B-cell receptor signaling and promotes development to the mature B-cell stage (PubMed:32612238). Repression of the cohesin-release factor WAPL causes global changes of the chromosomal architecture in pro-B cells to facilitate the generation of a diverse antibody repertoire (PubMed:32612238). {ECO:0000269|PubMed:10811620, ECO:0000269|PubMed:27181361, ECO:0000269|PubMed:32612238}.; FUNCTION: (Microbial infection) Plays an essential role in the maintenance of Epstein-Barr virus genome copy number within the host cell by promoting EBNA1/oriP-dependent binding and transcription (PubMed:31941781). Participates also in the inhibition of lytic EBV reactivation by modulating viral BZLF1 activity (PubMed:23678172). {ECO:0000269|PubMed:23678172, ECO:0000269|PubMed:31941781}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Hgene | JAK2 | 5080682 | PAX5 | 36966721 | ENST00000539801 | 17 | 24 | 37_380 | 8111 | 1133 | Domain | Note=FERM;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00084 |
Hgene | JAK2 | 5080682 | PAX5 | 36966721 | ENST00000539801 | 18 | 25 | 37_380 | 8111 | 1133 | Domain | Note=FERM;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00084 |
Hgene | JAK2 | 5080683 | PAX5 | 36966721 | ENST00000539801 | 17 | 24 | 37_380 | 8111 | 1133 | Domain | Note=FERM;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00084 |
Hgene | JAK2 | 5080683 | PAX5 | 36966721 | ENST00000539801 | 18 | 25 | 37_380 | 8111 | 1133 | Domain | Note=FERM;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00084 |
Hgene | JAK2 | 5080682 | PAX5 | 36966721 | ENST00000539801 | 17 | 24 | 545_809 | 8111 | 1133 | Domain | Note=Protein kinase 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | JAK2 | 5080682 | PAX5 | 36966721 | ENST00000539801 | 18 | 25 | 545_809 | 8111 | 1133 | Domain | Note=Protein kinase 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | JAK2 | 5080683 | PAX5 | 36966721 | ENST00000539801 | 17 | 24 | 545_809 | 8111 | 1133 | Domain | Note=Protein kinase 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | JAK2 | 5080683 | PAX5 | 36966721 | ENST00000539801 | 18 | 25 | 545_809 | 8111 | 1133 | Domain | Note=Protein kinase 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Hgene | JAK2 | 5080682 | PAX5 | 36966721 | ENST00000539801 | 17 | 24 | 401_482 | 8111 | 1133 | Domain | Note=SH2%3B atypical;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Hgene | JAK2 | 5080682 | PAX5 | 36966721 | ENST00000539801 | 18 | 25 | 401_482 | 8111 | 1133 | Domain | Note=SH2%3B atypical;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Hgene | JAK2 | 5080683 | PAX5 | 36966721 | ENST00000539801 | 17 | 24 | 401_482 | 8111 | 1133 | Domain | Note=SH2%3B atypical;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
Hgene | JAK2 | 5080683 | PAX5 | 36966721 | ENST00000539801 | 18 | 25 | 401_482 | 8111 | 1133 | Domain | Note=SH2%3B atypical;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>139_JAK2_PAX5 | ENST00000539801 | ENST00000358127 | JAK2 | chr9 | 5080683 | PAX5 | chr9 | 36966721 | MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSGEYVAEEICIAASKACGITPVYHNMFALMSE TERIWYPPNHVFHIDESTRHNVLYRIRFYFPRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKF EVKEPGSGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYK HCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVK FGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFT PGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIG SSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAA | 1001 |
3D view using mol* of 139_JAK2_PAX5 | ||||||||||
PDB file >>>HKFP_204_JAK2_PAX5 | ENST00000539801 | ENST00000358127 | JAK2 | chr9 | 5080682 | PAX5 | chr9 | 36966721 | MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSGEYVAEEICIAASKACGITPVYHNMFALMSE TERIWYPPNHVFHIDESTRHNVLYRIRFYFPRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKF EVKEPGSGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYK HCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVK FGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFT PGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIG SSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAA | 1001_JAK2_PAX5 |
PDB file >>>HKFP_205_JAK2_PAX5 | ENST00000539801 | ENST00000358127 | JAK2 | chr9 | 5080683 | PAX5 | chr9 | 36966721 | MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSGEYVAEEICIAASKACGITPVYHNMFALMSE TERIWYPPNHVFHIDESTRHNVLYRIRFYFPRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKF EVKEPGSGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYK HCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVK FGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFT PGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIG SSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAA | 1001_JAK2_PAX5 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
139_JAK2_PAX5.png |
139_JAK2_PAX5.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
139_JAK2_PAX5_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Zanubrutinib | -7.799739999999999 | -7.799739999999999 | -35.8369 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Tofacitinib | -7.62984 | -7.64134 | -36.8721 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Tofacitinib | -7.62984 | -7.64134 | -36.8721 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Upadacitinib | -7.60657 | -7.60757 | -37.7663 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Netarsudil | -7.5032 | -7.5143 | -57.2078 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Netarsudil | -7.5032 | -7.5143 | -57.2078 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Zanubrutinib | -7.49103 | -7.49103 | -38.0763 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Acalabrutinib | -7.44873 | -7.46283 | -51.586999999999996 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Acalabrutinib | -7.44873 | -7.46283 | -51.586999999999996 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Axitinib | -7.316910000000001 | -7.320110000000001 | -47.1801 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Lapatinib | -7.2172 | -7.306 | -63.3254 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Lapatinib | -7.09214 | -7.18094 | -62.0186 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Larotrectinib | -7.065939999999999 | -7.065939999999999 | -47.5227 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Afatinib | -7.05898 | -7.241280000000001 | -50.4155 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Afatinib | -7.05898 | -7.241280000000001 | -50.4155 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Afatinib | -7.057580000000001 | -7.241280000000001 | -50.4155 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Larotrectinib | -6.99223 | -6.99223 | -44.6375 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Regorafenib | -6.7660800000000005 | -6.7660800000000005 | -42.0719 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Palbociclib | -6.738689999999999 | -7.145589999999999 | -44.2614 |
139_JAK2_PAX5-DOCK_HTVS_1-001 | Palbociclib | -6.738689999999999 | -7.145589999999999 | -44.2614 |
Top |
Kinase-Substrate Information of JAK2_PAX5 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
JAK2 | O60674 | human | GTF2I | P78347-2 | Y248 | EESEDPDyyQyNIQG | |
JAK2 | O60674 | human | BECN1 | Q14457 | Y333 | QRYRLVPyGNHsYLE | APG6 |
JAK2 | O60674 | human | PAK1 | Q13153 | Y285 | QGASGTVyTAMDVAT | Pkinase |
JAK2 | O60674 | human | PRMT5 | O14744 | Y307 | FAKGyEDyLQsPLQP | PRMT5 |
JAK2 | O60674 | human | STAP2 | Q9UGK3 | Y250 | PFLLDEDyEKVLGyV | |
JAK2 | O60674 | human | GRB2 | P62993 | Y209 | TGMFPRNyVtPVNrN | |
JAK2 | O60674 | human | PRLR | P16471 | S349 | YLDPDTDsGRGSCDs | |
JAK2 | O60674 | human | EZH2 | Q15910 | Y641 | kNEFISEyCGEIISQ | SET |
JAK2 | O60674 | human | STAT5A | P42229 | Y694 | LAkAVDGyVkPQIkQ | |
JAK2 | O60674 | human | PPDPF | Q9H3Y8 | Y17 | LVATHDyyRRRLGst | |
JAK2 | O60674 | human | CCR2 | P41597 | Y139 | ILLTIDRyLAIVHAV | 7tm_1 |
JAK2 | O60674 | human | KDM3A | Q9Y4C1 | Y1101 | PDLGPKMyNAyGLIT | |
JAK2 | O60674 | human | BRD4 | O60885 | Y98 | kLNLPDyykIIKtPM | Bromodomain |
JAK2 | O60674 | human | JAK2 | O60674 | Y570 | VRREVGDyGQLHETE | PK_Tyr_Ser-Thr |
JAK2 | O60674 | human | PAK1 | Q13153 | Y153 | tDksAEDyNssNALN | |
JAK2 | O60674 | human | GRB2 | P62993 | Y52 | DGFIPkNyIEMkPHP | |
JAK2 | O60674 | human | SOCS3 | O14543 | Y221 | IREFLDQyDAPL___ | |
JAK2 | O60674 | human | STAT3 | P40763 | Y705 | DPGsAAPyLktKFIC | |
JAK2 | O60674 | human | PRMT5 | O14744 | Y304 | yELFAKGyEDyLQsP | PRMT5 |
JAK2 | O60674 | human | STAP2 | Q9UGK3 | Y22 | GVLPSHYyESFLEKK | PH |
JAK2 | O60674 | human | GAB2 | Q9UQC2 | Y643 | tsDEKVDyVQVDKEK | |
JAK2 | O60674 | human | MAP3K5 | Q99683 | Y718 | IPERDSRySQPLHEE | Pkinase |
JAK2 | O60674 | human | ARHGEF1 | Q92888 | Y738 | WDQEAQIyELVAQTV | PH_16 |
JAK2 | O60674 | human | H3C1 | P68431 | Y41 | GVkkPHryrPGtVAL | Histone |
JAK2 | O60674 | human | GRB2 | P62993 | Y37 | EECDQNWykAELNGk | SH3_1 |
JAK2 | O60674 | human | GRB2 | P62993 | Y7 | _MEAIAkyDFkATAD | SH3_1 |
JAK2 | O60674 | human | JAK2 | O60674 | S523 | GVsDVPtsPTLQRPT | |
JAK2 | O60674 | human | PPDPF | Q9H3Y8 | Y16 | sLVATHDyyRRRLGs | |
JAK2 | O60674 | human | STAP2 | Q9UGK3 | Y322 | GDGPAVDyENQDVAS | |
JAK2 | O60674 | human | TET2 | Q6N021 | Y1964 | HETSEPTyLRFIKSL | |
JAK2 | O60674 | human | CHEK2 | O96017 | Y156 | EVGPKNSyIAYIEDH | FHA |
JAK2 | O60674 | human | PBK | Q96KB5 | Y74 | NPICNDHyRsVyQkR | Pkinase |
JAK2 | O60674 | human | STAP2 | Q9UGK3 | Y310 | LPNQEENyVTPIGDG | |
JAK2 | O60674 | human | PRMT5 | O14744 | Y297 | NRPPPNAyELFAKGy | PRMT5 |
JAK2 | O60674 | human | MAPK1 | P28482 | Y187 | HtGFLtEyVAtRWyr | Pkinase |
JAK2 | O60674 | human | JAK2 | O60674 | Y119 | VLYRIRFyFPRWYCS | FERM_F1 |
JAK2 | O60674 | human | PDHA1 | P08559 | Y301 | MsDPGVsyRtREEIQ | E1_dh |
JAK2 | O60674 | human | SOCS3 | O14543 | Y204 | VNGHLDSyEkVTQLP | |
JAK2 | O60674 | human | PDK1 | Q15118 | Y243 | ARRLCDLyyINSPEL | |
JAK2 | O60674 | human | BRD4 | O60885 | Y97 | VkLNLPDyykIIKtP | Bromodomain |
JAK2 | O60674 | human | MAPK3 | P27361 | Y204 | HtGFLtEyVAtRWyr | Pkinase |
JAK2 | O60674 | human | PAK1 | Q13153 | Y201 | PEHtKsVyTRsVIEP | |
JAK2 | O60674 | human | TET2 | Q6N021 | Y1939 | CEKYGPDyVPQKSHG | |
JAK2 | O60674 | human | STAT1 | P42224 | Y701 | DGPkGtGyIktELIs |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
JAK2 | ID | Description | 0.00e+00 |
JAK2 | GO:0007259 | receptor signaling pathway via JAK-STAT | 3.87e-06 |
JAK2 | GO:0097696 | receptor signaling pathway via STAT | 3.87e-06 |
JAK2 | GO:0071375 | cellular response to peptide hormone stimulus | 3.87e-06 |
JAK2 | GO:1901653 | cellular response to peptide | 1.25e-05 |
JAK2 | GO:0043434 | response to peptide hormone | 2.93e-05 |
JAK2 | GO:0060397 | growth hormone receptor signaling pathway via JAK-STAT | 7.35e-05 |
JAK2 | GO:0000302 | response to reactive oxygen species | 7.56e-05 |
JAK2 | GO:0034198 | cellular response to amino acid starvation | 1.40e-04 |
JAK2 | GO:1990928 | response to amino acid starvation | 1.57e-04 |
JAK2 | GO:0006979 | response to oxidative stress | 1.59e-04 |
JAK2 | GO:0051347 | positive regulation of transferase activity | 1.82e-04 |
JAK2 | GO:0048732 | gland development | 2.58e-04 |
JAK2 | GO:0034614 | cellular response to reactive oxygen species | 2.58e-04 |
JAK2 | GO:0070665 | positive regulation of leukocyte proliferation | 3.46e-04 |
JAK2 | GO:0001659 | temperature homeostasis | 5.21e-04 |
JAK2 | GO:0060396 | growth hormone receptor signaling pathway | 5.21e-04 |
JAK2 | GO:0071378 | cellular response to growth hormone stimulus | 5.32e-04 |
JAK2 | GO:0042063 | gliogenesis | 5.32e-04 |
JAK2 | GO:0009755 | hormone-mediated signaling pathway | 5.32e-04 |
JAK2 | GO:0046777 | protein autophosphorylation | 5.87e-04 |
JAK2 | GO:0030522 | intracellular receptor signaling pathway | 5.88e-04 |
JAK2 | GO:0032869 | cellular response to insulin stimulus | 6.31e-04 |
JAK2 | GO:0042542 | response to hydrogen peroxide | 7.28e-04 |
JAK2 | GO:0120162 | positive regulation of cold-induced thermogenesis | 7.28e-04 |
JAK2 | GO:0071356 | cellular response to tumor necrosis factor | 1.12e-03 |
JAK2 | GO:0060416 | response to growth hormone | 1.16e-03 |
JAK2 | GO:0048863 | stem cell differentiation | 1.21e-03 |
JAK2 | GO:0050727 | regulation of inflammatory response | 1.25e-03 |
JAK2 | GO:0030518 | intracellular steroid hormone receptor signaling pathway | 1.25e-03 |
JAK2 | GO:0030099 | myeloid cell differentiation | 1.25e-03 |
JAK2 | GO:0034599 | cellular response to oxidative stress | 1.25e-03 |
JAK2 | GO:0008286 | insulin receptor signaling pathway | 1.27e-03 |
JAK2 | GO:0034612 | response to tumor necrosis factor | 1.27e-03 |
JAK2 | GO:0045022 | early endosome to late endosome transport | 1.35e-03 |
JAK2 | GO:0070663 | regulation of leukocyte proliferation | 1.35e-03 |
JAK2 | GO:0032868 | response to insulin | 1.35e-03 |
JAK2 | GO:1905521 | regulation of macrophage migration | 1.35e-03 |
JAK2 | GO:0030879 | mammary gland development | 1.35e-03 |
JAK2 | GO:0060711 | labyrinthine layer development | 1.35e-03 |
JAK2 | GO:0070849 | response to epidermal growth factor | 1.35e-03 |
JAK2 | GO:0072538 | T-helper 17 type immune response | 1.40e-03 |
JAK2 | GO:0043401 | steroid hormone mediated signaling pathway | 1.42e-03 |
JAK2 | GO:0045860 | positive regulation of protein kinase activity | 1.46e-03 |
JAK2 | GO:0098927 | vesicle-mediated transport between endosomal compartments | 1.48e-03 |
JAK2 | GO:0048009 | insulin-like growth factor receptor signaling pathway | 1.73e-03 |
JAK2 | GO:0120161 | regulation of cold-induced thermogenesis | 1.80e-03 |
JAK2 | GO:0106106 | cold-induced thermogenesis | 1.81e-03 |
JAK2 | GO:0048872 | homeostasis of number of cells | 2.23e-03 |
JAK2 | GO:0062197 | cellular response to chemical stress | 2.23e-03 |
Top |
Related Drugs to JAK2_PAX5 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning JAK2-PAX5 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to JAK2_PAX5 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | JAK2 | C0032463 | Polycythemia Vera | 12 | CTD_human;ORPHANET;UNIPROT |
Hgene | JAK2 | C0040028 | Thrombocythemia, Essential | 10 | CTD_human;ORPHANET |
Hgene | JAK2 | C0001815 | Primary Myelofibrosis | 9 | CGI;CTD_human;GENOMICS_ENGLAND;ORPHANET |
Hgene | JAK2 | C3489628 | Thrombocytosis, Autosomal Dominant | 8 | CTD_human |
Hgene | JAK2 | C0019154 | Hepatic Vein Thrombosis | 3 | CTD_human;ORPHANET |
Hgene | JAK2 | C0856761 | Budd-Chiari Syndrome | 3 | CTD_human;ORPHANET |
Hgene | JAK2 | C0009324 | Ulcerative Colitis | 2 | CTD_human |
Hgene | JAK2 | C0027022 | Myeloproliferative disease | 2 | CTD_human |
Hgene | JAK2 | C0151744 | Myocardial Ischemia | 2 | CTD_human |
Hgene | JAK2 | C0836924 | Thrombocytosis | 2 | CTD_human |
Hgene | JAK2 | C3281125 | THROMBOCYTHEMIA 3 | 2 | UNIPROT |
Tgene | PAX5 | C0006413 | Burkitt Lymphoma | 4 | ORPHANET |
Tgene | PAX5 | C1292769 | Precursor B-cell lymphoblastic leukemia | 4 | ORPHANET |
Tgene | PAX5 | C0023485 | Precursor B-Cell Lymphoblastic Leukemia-Lymphoma | 2 | CTD_human |
Tgene | PAX5 | C1961102 | Precursor Cell Lymphoblastic Leukemia Lymphoma | 2 | CGI;CTD_human;UNIPROT |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |