UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Kinase Fusion Gene:LONP1_MAP2K7 |
Kinase Fusion Protein Summary |
Kinase Fusion gene summary |
Kinase Fusion partner gene information | Kinase Fusion gene name: LONP1_MAP2K7 | KinaseFusionDB ID: KFG3196 | FusionGDB2.0 ID: KFG3196 | Hgene | Tgene | Gene symbol | LONP1 | MAP2K7 | Gene ID | 9361 | 5609 | |
Gene name | lon peptidase 1, mitochondrial | mitogen-activated protein kinase kinase 7 | ||||||||||
Synonyms | CODASS|LON|LONP|LonHS|PIM1|PRSS15|hLON | JNKK2|MAPKK7|MEK|MEK 7|MKK7|PRKMK7|SAPKK-4|SAPKK4 | ||||||||||
Cytomap | 19p13.3 | 19p13.2 | ||||||||||
Type of gene | protein-coding | protein-coding | ||||||||||
Description | lon protease homolog, mitochondrialhLON ATP-dependent proteasemitochondrial ATP-dependent protease Lonmitochondrial lon protease-like proteinserine protease 15 | dual specificity mitogen-activated protein kinase kinase 7JNK-activating kinase 2MAP kinase kinase 7MAPK/ERK kinase 7SAPK kinase 4c-Jun N-terminal kinase kinase 2stress-activated protein kinase kinase 4 | ||||||||||
Modification date | 20240411 | 20240416 | ||||||||||
UniProtAcc | P36776 | O14733 | ||||||||||
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000590511, ENST00000360614, ENST00000590729, ENST00000593119, ENST00000585374, ENST00000540670, | ENST00000397979, ENST00000397981, ENST00000397983, ENST00000545011, | |||||||||
Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: LONP1 [Title/Abstract] AND MAP2K7 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | LONP1(5719715)-MAP2K7(7974640), # samples:3 |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | LONP1 | GO:0030163 | protein catabolic process | 37327776 |
Hgene | LONP1 | GO:0034599 | cellular response to oxidative stress | 17420247 |
Hgene | LONP1 | GO:0051603 | proteolysis involved in protein catabolic process | 8248235|17420247 |
Tgene | MAP2K7 | GO:0006970 | response to osmotic stress | 9535930 |
Tgene | MAP2K7 | GO:0009408 | response to heat | 9535930 |
Tgene | MAP2K7 | GO:0009411 | response to UV | 9535930 |
Tgene | MAP2K7 | GO:0034612 | response to tumor necrosis factor | 9535930 |
Tgene | MAP2K7 | GO:0051403 | stress-activated MAPK cascade | 9535930 |
Kinase Fusion gene breakpoints across LONP1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Kinase Fusion gene breakpoints across MAP2K7 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
Kinase Fusion gene information. |
Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
ChimerDB4 | TCGA-C8-A12L-01A | LONP1 | chr19 | 5719715 | MAP2K7 | chr19 | 7974640 |
ChimerDB4 | TCGA-C8-A12L | LONP1 | chr19 | 5719714 | MAP2K7 | chr19 | 7974639 |
Top |
Kinase Fusion ORF Analysis |
Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
ENST00000585374 | ENST00000397981 | LONP1 | chr19 | 5719715 | MAP2K7 | chr19 | 7974640 | 3438 | 458 |
ENST00000585374 | ENST00000397981 | LONP1 | chr19 | 5719714 | MAP2K7 | chr19 | 7974639 | 3438 | 458 |
Top |
Kinase Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000585374_ENST00000397981_LONP1_chr19_5719715_MAP2K7_chr19_7974640_length(amino acids)=458 MAASTGYVRLWGAARCWVLRRPMLAAAGGRRGRRGRPGHNGAHAHDDPRCVSAPAAHRHHPQPGVPALYQDYRALQLPLANDGGSRSPSS ESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAV KQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHG VIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLPCPSPSQVELATGQFP YKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLS -------------------------------------------------------------- >ENST00000585374_ENST00000397981_LONP1_chr19_5719714_MAP2K7_chr19_7974639_length(amino acids)=458 MAASTGYVRLWGAARCWVLRRPMLAAAGGRRGRRGRPGHNGAHAHDDPRCVSAPAAHRHHPQPGVPALYQDYRALQLPLANDGGSRSPSS ESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAV KQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHG VIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLPCPSPSQVELATGQFP YKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLS -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:5719715/chr19:7974640) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
LONP1 | MAP2K7 |
FUNCTION: ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix (PubMed:12198491, PubMed:15870080, PubMed:8248235, PubMed:17579211, PubMed:37327776). Endogenous substrates include mitochondrial steroidogenic acute regulatory (StAR) protein, DELE1, helicase Twinkle (TWNK) and the large ribosomal subunit protein MRPL32/bL32m (PubMed:17579211, PubMed:28377575, PubMed:37327776). MRPL32/bL32m is protected from degradation by LONP1 when it is bound to a nucleic acid (RNA), but TWNK is not (PubMed:17579211, PubMed:28377575). May also have a chaperone function in the assembly of inner membrane protein complexes (By similarity). Participates in the regulation of mitochondrial gene expression and in the maintenance of the integrity of the mitochondrial genome (PubMed:17420247). Binds to mitochondrial promoters and RNA in a single-stranded, site-specific, and strand-specific manner (PubMed:17420247). May regulate mitochondrial DNA replication and/or gene expression using site-specific, single-stranded DNA binding to target the degradation of regulatory proteins binding to adjacent sites in mitochondrial promoters (PubMed:14739292, PubMed:17420247). {ECO:0000255|HAMAP-Rule:MF_03120, ECO:0000269|PubMed:12198491, ECO:0000269|PubMed:14739292, ECO:0000269|PubMed:15870080, ECO:0000269|PubMed:17420247, ECO:0000269|PubMed:17579211, ECO:0000269|PubMed:28377575, ECO:0000269|PubMed:37327776, ECO:0000269|PubMed:8248235}. | FUNCTION: Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Essential component of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. With MAP2K4/MKK4, is the one of the only known kinase to directly activate the stress-activated protein kinase/c-Jun N-terminal kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3. MAP2K4/MKK4 and MAP2K7/MKK7 both activate the JNKs by phosphorylation, but they differ in their preference for the phosphorylation site in the Thr-Pro-Tyr motif. MAP2K4/MKK4 shows preference for phosphorylation of the Tyr residue and MAP2K7/MKK7 for the Thr residue. The monophosphorylation of JNKs on the Thr residue is sufficient to increase JNK activity indicating that MAP2K7/MKK7 is important to trigger JNK activity, while the additional phosphorylation of the Tyr residue by MAP2K4/MKK4 ensures optimal JNK activation. Has a specific role in JNK signal transduction pathway activated by pro-inflammatory cytokines. The MKK/JNK signaling pathway is also involved in mitochondrial death signaling pathway, including the release cytochrome c, leading to apoptosis. Part of a non-canonical MAPK signaling pathway, composed of the upstream MAP3K12 kinase and downstream MAP kinases MAPK1/ERK2 and MAPK3/ERK1, that enhances the AP-1-mediated transcription of APP in response to APOE (PubMed:28111074). {ECO:0000269|PubMed:28111074, ECO:0000269|PubMed:9312068, ECO:0000269|PubMed:9372971, ECO:0000269|PubMed:9535930, ECO:0000269|Ref.5}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
- Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Tgene | LONP1 | 5719714 | MAP2K7 | 7974639 | ENST00000585374 | 0 | 11 | 120_380 | 41 | 420 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | LONP1 | 5719714 | MAP2K7 | 7974639 | ENST00000585374 | 0 | 11 | 120_380 | 41 | 427 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | LONP1 | 5719714 | MAP2K7 | 7974639 | ENST00000585374 | 1 | 12 | 120_380 | 57 | 436 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | LONP1 | 5719715 | MAP2K7 | 7974640 | ENST00000585374 | 0 | 11 | 120_380 | 41 | 420 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | LONP1 | 5719715 | MAP2K7 | 7974640 | ENST00000585374 | 0 | 11 | 120_380 | 41 | 427 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Tgene | LONP1 | 5719715 | MAP2K7 | 7974640 | ENST00000585374 | 1 | 12 | 120_380 | 57 | 436 | Domain | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 |
Top |
Kinase Fusion Protein Structures |
CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
PDB file >>>287_LONP1_MAP2K7 | ENST00000585374 | ENST00000397981 | LONP1 | chr19 | 5719714 | MAP2K7 | chr19 | 7974639 | MAASTGYVRLWGAARCWVLRRPMLAAAGGRRGRRGRPGHNGAHAHDDPRCVSAPAAHRHHPQPGVPALYQDYRALQLPLANDGGSRSPSS ESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAV KQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHG VIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLPCPSPSQVELATGQFP YKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLS | 458 |
3D view using mol* of 287_LONP1_MAP2K7 | ||||||||||
PDB file >>>TKFP_501_LONP1_MAP2K7 | ENST00000585374 | ENST00000397981 | LONP1 | chr19 | 5719715 | MAP2K7 | chr19 | 7974640 | MAASTGYVRLWGAARCWVLRRPMLAAAGGRRGRRGRPGHNGAHAHDDPRCVSAPAAHRHHPQPGVPALYQDYRALQLPLANDGGSRSPSS ESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAV KQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHG VIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLPCPSPSQVELATGQFP YKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLS | 458_LONP1_MAP2K7 |
PDB file >>>TKFP_502_LONP1_MAP2K7 | ENST00000585374 | ENST00000397981 | LONP1 | chr19 | 5719714 | MAP2K7 | chr19 | 7974639 | MAASTGYVRLWGAARCWVLRRPMLAAAGGRRGRRGRPGHNGAHAHDDPRCVSAPAAHRHHPQPGVPALYQDYRALQLPLANDGGSRSPSS ESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAV KQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHG VIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLPCPSPSQVELATGQFP YKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLS | 458_LONP1_MAP2K7 |
Top |
Comparison of Fusion Protein Isoforms |
Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
287_LONP1_MAP2K7.png |
287_LONP1_MAP2K7.png |
Top |
Potential Active Site Information |
The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
287_LONP1_MAP2K7_ramachandran.png |
Top |
Virtual Screening Results |
Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
5'-kinase fusion protein case |
3'-kinase fusion protein case |
Top |
Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
Top |
Kinase-Substrate Information of LONP1_MAP2K7 |
Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
MAP2K7 | O14733 | human | MAPK10 | P53779-2 | T221 | AGTSFMMtPyVVTRY | Pkinase |
MAP2K7 | O14733 | human | MAPK9 | P45984 | T183 | ACtNFMMtPyVVtRY | Pkinase |
MAP2K7 | O14733 | human | MAPK8 | P45983 | Y185 | tsFMMtPyVVtRYYR | Pkinase |
MAP2K7 | O14733 | human | MAPK9 | P45984 | S407 | STEQtLAsDTDSSLD | |
MAP2K7 | O14733 | human | MAPK8 | P45983 | T183 | AGtsFMMtPyVVtRY | Pkinase |
MAP2K7 | O14733 | human | FADD | Q13158 | S194 | QNRsGAMsPMsWNsD | |
MAP2K7 | O14733 | human | MAPK9 | P45984 | T404 | SSMSTEQtLAsDTDS | |
MAP2K7 | O14733 | human | MAPK8 | P45983-2 | T183 | AGTSFMMtPyVVTRY | Pkinase |
MAP2K7 | O14733 | human | MAPK10 | P53779 | T221 | AGtsFMMtPyVVtRY | Pkinase |
Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
Enriched GO biological processes of the phosphorylation target genes of the kinase |
Kinase | GOID | GO term | P.adjust |
MAP2K7 | ID | Description | 0.00e+00 |
MAP2K7 | GO:0038095 | Fc-epsilon receptor signaling pathway | 2.57e-06 |
MAP2K7 | GO:0038093 | Fc receptor signaling pathway | 1.55e-05 |
MAP2K7 | GO:0090398 | cellular senescence | 6.69e-05 |
MAP2K7 | GO:0042752 | regulation of circadian rhythm | 6.69e-05 |
MAP2K7 | GO:0007254 | JNK cascade | 1.57e-04 |
MAP2K7 | GO:0007623 | circadian rhythm | 2.58e-04 |
MAP2K7 | GO:0051403 | stress-activated MAPK cascade | 3.07e-04 |
MAP2K7 | GO:0031098 | stress-activated protein kinase signaling cascade | 3.07e-04 |
MAP2K7 | GO:0048511 | rhythmic process | 5.25e-04 |
MAP2K7 | GO:0071276 | cellular response to cadmium ion | 6.86e-04 |
MAP2K7 | GO:0002768 | immune response-regulating cell surface receptor signaling pathway | 6.86e-04 |
MAP2K7 | GO:0046686 | response to cadmium ion | 1.50e-03 |
MAP2K7 | GO:0002764 | immune response-regulating signaling pathway | 1.75e-03 |
MAP2K7 | GO:0071260 | cellular response to mechanical stimulus | 1.92e-03 |
MAP2K7 | GO:0031343 | positive regulation of cell killing | 1.99e-03 |
MAP2K7 | GO:0031341 | regulation of cell killing | 3.99e-03 |
MAP2K7 | GO:2001235 | positive regulation of apoptotic signaling pathway | 6.41e-03 |
MAP2K7 | GO:0034614 | cellular response to reactive oxygen species | 6.83e-03 |
MAP2K7 | GO:0031334 | positive regulation of protein-containing complex assembly | 1.03e-02 |
MAP2K7 | GO:0071248 | cellular response to metal ion | 1.03e-02 |
MAP2K7 | GO:0000302 | response to reactive oxygen species | 1.04e-02 |
MAP2K7 | GO:0009612 | response to mechanical stimulus | 1.07e-02 |
MAP2K7 | GO:0001906 | cell killing | 1.12e-02 |
MAP2K7 | GO:0071241 | cellular response to inorganic substance | 1.13e-02 |
MAP2K7 | GO:0034599 | cellular response to oxidative stress | 1.34e-02 |
MAP2K7 | GO:0018105 | peptidyl-serine phosphorylation | 1.72e-02 |
MAP2K7 | GO:0018209 | peptidyl-serine modification | 1.79e-02 |
MAP2K7 | GO:0062197 | cellular response to chemical stress | 1.79e-02 |
MAP2K7 | GO:0009416 | response to light stimulus | 1.79e-02 |
MAP2K7 | GO:0071214 | cellular response to abiotic stimulus | 1.84e-02 |
MAP2K7 | GO:0104004 | cellular response to environmental stimulus | 1.84e-02 |
MAP2K7 | GO:0045089 | positive regulation of innate immune response | 1.84e-02 |
MAP2K7 | GO:0071496 | cellular response to external stimulus | 1.84e-02 |
MAP2K7 | GO:0045862 | positive regulation of proteolysis | 1.84e-02 |
MAP2K7 | GO:0010038 | response to metal ion | 1.84e-02 |
MAP2K7 | GO:0071803 | positive regulation of podosome assembly | 1.84e-02 |
MAP2K7 | GO:0002833 | positive regulation of response to biotic stimulus | 1.89e-02 |
MAP2K7 | GO:1901030 | positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway | 1.95e-02 |
MAP2K7 | GO:2001233 | regulation of apoptotic signaling pathway | 1.95e-02 |
MAP2K7 | GO:0006979 | response to oxidative stress | 1.95e-02 |
MAP2K7 | GO:0036462 | TRAIL-activated apoptotic signaling pathway | 1.95e-02 |
MAP2K7 | GO:0071801 | regulation of podosome assembly | 1.95e-02 |
MAP2K7 | GO:0072683 | T cell extravasation | 1.95e-02 |
MAP2K7 | GO:0043254 | regulation of protein-containing complex assembly | 1.95e-02 |
MAP2K7 | GO:0045088 | regulation of innate immune response | 1.95e-02 |
MAP2K7 | GO:0048148 | behavioral response to cocaine | 1.95e-02 |
MAP2K7 | GO:0097202 | activation of cysteine-type endopeptidase activity | 1.95e-02 |
MAP2K7 | GO:0009314 | response to radiation | 1.95e-02 |
MAP2K7 | GO:0045651 | positive regulation of macrophage differentiation | 2.16e-02 |
Top |
Related Drugs to LONP1_MAP2K7 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Distribution of the number of studies mentioning LONP1-MAP2K7 and kinase inhibitors the PubMed Abstract (04-01-2024) |
Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to LONP1_MAP2K7 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
MeSH ID | MeSH term |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
Clinical Trials from clinicaltrials.gov (06-17-2024) |
Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |