| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Kinase Fusion Gene:MAP3K3_SMURF2 |
Kinase Fusion Protein Summary |
 Kinase Fusion gene summary |
| Kinase Fusion partner gene information | Kinase Fusion gene name: MAP3K3_SMURF2 | KinaseFusionDB ID: KFG3408 | FusionGDB2.0 ID: KFG3408 | Hgene | Tgene | Gene symbol | MAP3K3 | SMURF2 | Gene ID | 4215 | 64750 | |
| Gene name | mitogen-activated protein kinase kinase kinase 3 | SMAD specific E3 ubiquitin protein ligase 2 | ||||||||||
| Synonyms | MAPKKK3|MEKK3 | - | ||||||||||
| Cytomap | 17q23.3 | 17q23.3-q24.1 | ||||||||||
| Type of gene | protein-coding | protein-coding | ||||||||||
| Description | mitogen-activated protein kinase kinase kinase 3MAP/ERK kinase kinase 3MAPK/ERK kinase kinase 3MEK kinase 3MEKK 3 | E3 ubiquitin-protein ligase SMURF2E3 ubiquitin ligase SMURF2HECT-type E3 ubiquitin transferase SMURF2SMAD ubiquitination regulatory factor 2hSMURF2 | ||||||||||
| Modification date | 20240305 | 20240411 | ||||||||||
| UniProtAcc | Q99759 | Q9HAU4 | ||||||||||
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000579585, ENST00000584573, ENST00000361733, ENST00000361357, ENST00000577395, ENST00000577784, | ENST00000262435, ENST00000578200, | |||||||||
| Context (manual curation of fusion genes in KinaseFusionDB) | PubMed: MAP3K3 [Title/Abstract] AND SMURF2 [Title/Abstract] AND fusion [Title/Abstract] | |||||||||||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ||||||||||||
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | MAP3K3 | GO:0035556 | intracellular signal transduction | 15001576 |
| Hgene | MAP3K3 | GO:0046777 | protein autophosphorylation | 15001576 |
| Tgene | SMURF2 | GO:0006511 | ubiquitin-dependent protein catabolic process | 14755250 |
| Tgene | SMURF2 | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway | 19255252 |
| Tgene | SMURF2 | GO:1901165 | positive regulation of trophoblast cell migration | 19255252 |
| Kinase Fusion gene breakpoints across MAP3K3 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Kinase Fusion gene breakpoints across SMURF2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Kinase Fusion Gene Sample Information |
| Kinase Fusion gene information. |
| Kinase Fusion gene information from four resources (ChiTars 5.0, ChimerDB 4.0, COSMIC, and CCLE) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Sample | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp |
| CCLE | 95T1000 | MAP3K3 | chr17 | 61762950 | SMURF2 | chr17 | 62553840 |
| CCLE | 95T1000 | MAP3K3 | chr17 | 61762938 | SMURF2 | chr17 | 62553840 |
Top |
Kinase Fusion ORF Analysis |
| Kinase Fusion information from ORFfinder translation from full-length transcript sequence from KinaseFusionDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | Seq length (transcript) | Seq length (amino acids) |
| ENST00000579585 | ENST00000262435 | MAP3K3 | chr17 | 61762950 | SMURF2 | chr17 | 62553840 | 2283 | 577 |
Top |
Kinase Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from KinaseFusionDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >Henst_Tenst_Hgene_Hchr_Hbp_Tgene_Tchr_Tbp_length(fusion AA)_AAseq >ENST00000579585_ENST00000262435_MAP3K3_chr17_61762950_SMURF2_chr17_62553840_length(amino acids)=577 MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSALLNSPTVTTSSCAGASEKKKFLSDVRIKFEHNGERRIIA FSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAG DINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADREW LYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHN SLVWILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKE LELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLP -------------------------------------------------------------- |
Multiple Sequence Alignment of All Fusion Protein Isoforms |
Top |
Kinase Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr17:/chr17:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| MAP3K3 | SMURF2 |
| FUNCTION: Component of a protein kinase signal transduction cascade. Mediates activation of the NF-kappa-B, AP1 and DDIT3 transcriptional regulators. {ECO:0000269|PubMed:12912994, ECO:0000269|PubMed:14661019, ECO:0000269|PubMed:14743216, ECO:0000269|PubMed:9006902}. | FUNCTION: E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates (PubMed:11016919). Interacts with SMAD7 to trigger SMAD7-mediated transforming growth factor beta/TGF-beta receptor ubiquitin-dependent degradation, thereby down-regulating TGF-beta signaling (PubMed:11163210, PubMed:12717440, PubMed:21791611). In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with AIMP1 (PubMed:18448069). Also forms a stable complex with TGF-beta receptor-mediated phosphorylated SMAD1, SMAD2 and SMAD3, and targets SMAD1 and SMAD2 for ubiquitination and proteasome-mediated degradation (PubMed:11016919, PubMed:11158580, PubMed:11389444). SMAD2 may recruit substrates, such as SNON, for ubiquitin-dependent degradation (PubMed:11389444). Negatively regulates TGFB1-induced epithelial-mesenchymal transition and myofibroblast differentiation (PubMed:30696809). {ECO:0000269|PubMed:11016919, ECO:0000269|PubMed:11158580, ECO:0000269|PubMed:11163210, ECO:0000269|PubMed:11389444, ECO:0000269|PubMed:12717440, ECO:0000269|PubMed:18448069, ECO:0000269|PubMed:21791611, ECO:0000269|PubMed:30696809}.; FUNCTION: (Microbial infection) In case of filoviruses Ebola/EBOV and Marburg/MARV infection, the complex formed by viral matrix protein VP40 and SMURF2 facilitates virus budding. {ECO:0000269|PubMed:33673144}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained domain in the 5'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
| Hgene | MAP3K3 | 61762950 | SMURF2 | 62553840 | ENST00000579585 | 10 | 18 | 44_123 | 2671 | 658 | Domain | Note=PB1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01081 |
| Hgene | MAP3K3 | 61762950 | SMURF2 | 62553840 | ENST00000579585 | 8 | 16 | 44_123 | 2361 | 627 | Domain | Note=PB1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01081 |
| Hgene | MAP3K3 | 61762950 | SMURF2 | 62553840 | ENST00000579585 | 9 | 17 | 44_123 | 2671 | 658 | Domain | Note=PB1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01081 |
| - Retained domain in the 3'-partner of fusion protein (protein functional feature from UniProt). |
| Partner | Hgeneene | Hbp | Tgeneene | Tbp | ENST | BPexon | TotalExon | Protein feature loci | BPloci | TotalLen | Feature | Note |
Top |
Kinase Fusion Protein Structures |
| CIF files of the predicted kinase fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Kinase Fusion protein CIF link (fusion AA seq ID in KinaseFusionDB) | Henst | Tenst | Hgene | Hchr | Hbp | Tgene | Tchr | Tbp | AA seq | Len(AA seq) |
| PDB file >>>155_MAP3K3_SMURF2 | ENST00000579585 | ENST00000262435 | MAP3K3 | chr17 | 61762950 | SMURF2 | chr17 | 62553840 | MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSALLNSPTVTTSSCAGASEKKKFLSDVRIKFEHNGERRIIA FSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAG DINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADREW LYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHN SLVWILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKE LELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLP | 577 |
| 3D view using mol* of 155_MAP3K3_SMURF2 | ||||||||||
| PDB file >>>HKFP_228_MAP3K3_SMURF2 | ENST00000579585 | ENST00000262435 | MAP3K3 | chr17 | 61762950 | SMURF2 | chr17 | 62553840 | MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSALLNSPTVTTSSCAGASEKKKFLSDVRIKFEHNGERRIIA FSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAG DINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADREW LYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHN SLVWILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKE LELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLP | 577_MAP3K3_SMURF2 |
Top |
Comparison of Fusion Protein Isoforms |
| Superimpose the 3D Structures Among All Fusion Protein Isoforms * Download the pdb file and open it from the molstar online viewer. |
| Comparison of the Secondary Structures of Fusion Protein Isoforms |
Top |
Comparison of Fusion Protein Sequences/Structures with Known Sequences/Structures from PDB |
Top |
pLDDT score distribution |
| pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. * The blue color at the bottom marks the best active site residues. |
| 155_MAP3K3_SMURF2.png |
 |
| 155_MAP3K3_SMURF2.png |
 |
Top |
Potential Active Site Information |
| The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
| Kinase Fusion AA seq ID in KinaseFusionDB | Site score | Size | Dscore | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
Top |
Ramachandran Plot of Kinase Fusion Protein Structure |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| 155_MAP3K3_SMURF2_ramachandran.png |
 |
Top |
Virtual Screening Results |
| Distribution of the average docking score across all approved kinase inhibitors. Distribution of the number of occurrence across all approved kinase inhibitors. |
| 5'-kinase fusion protein case |
 |
| 3'-kinase fusion protein case |
Top |
| Drug information from DrugBank of the top 20 interacting small molecules. * The detailed information of individual kinase inhibitors are available in the download page. |
| Fusion gene name info | Drug | Docking score | Glide g score | Glide energy |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Netarsudil | -8.89672 | -8.90782 | -58.9774 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Netarsudil | -8.89672 | -8.90782 | -58.9774 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Dacomitinib | -8.46774 | -8.576039999999999 | -58.6605 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Dacomitinib | -8.46774 | -8.576039999999999 | -58.6605 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Lapatinib | -8.06482 | -8.15362 | -55.5549 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Pazopanib | -7.95976 | -7.966660000000001 | -55.156000000000006 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Pazopanib | -7.95976 | -7.966660000000001 | -55.156000000000006 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Selpercatinib | -7.944369999999999 | -7.97487 | -36.053000000000004 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Nilotinib | -7.895239999999999 | -8.034839999999999 | -57.0944 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Nilotinib | -7.895239999999999 | -8.034839999999999 | -57.0944 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Vemurafenib | -7.8569 | -8.2361 | -56.4634 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Vemurafenib | -7.8569 | -8.2361 | -56.4634 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Tepotinib | -7.8313 | -7.8324 | -60.5399 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Trametinib | -7.77447 | -7.77447 | -46.7589 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Lapatinib | -7.7636199999999995 | -7.8524199999999995 | -57.7121 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Mobocertinib | -7.5777 | -7.5854 | -56.9974 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Cobimetinib | -7.55335 | -7.55615 | -44.2466 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Netarsudil | -7.54501 | -7.55611 | -54.5026 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Netarsudil | -7.54501 | -7.55611 | -54.5026 |
| 155_MAP3K3_SMURF2-DOCK_HTVS_1-001 | Tepotinib | -7.50771 | -7.50881 | -60.415 |
Top |
Kinase-Substrate Information of MAP3K3_SMURF2 |
| Phosphorylation target of the kinase (phosphosite, 03-17-2024) |
| Kinase | Kinase UniProt Acc | Kinase species | Substrate | Substrate UniProt Acc | Substrate phosphorylated residues | Substrate phosphorylated sites (+/-7AA) | Domain |
| MAP3K3 | Q99759 | human | GLI1 | P08151 | S201 | PLEGDMSsPNstGIQ | |
| MAP3K3 | Q99759 | human | GLI1 | P08151 | S243 | DCRWDGCsQEFDSQE | |
| MAP3K3 | Q99759 | human | RCAN1 | P53805 | S163 | PDKQFLIsPPAsPPV | Calcipressin |
| MAP3K3 | Q99759 | human | RCAN1 | P53805 | S167 | FLIsPPAsPPVGWKQ | Calcipressin |
| MAP3K3 | Q99759 | human | GLI1 | P08151 | T1074 | QRGSsGHtPPPsGPP | |
| MAP3K3 | Q99759 | human | GLI1 | P08151 | S1078 | sGHtPPPsGPPNMAV | |
| MAP3K3 | Q99759 | human | GLI1 | P08151 | S968 | SGSYPTPsPCHENFV | |
| MAP3K3 | Q99759 | human | GLI1 | P08151 | S204 | GDMSsPNstGIQDPL |
| Biological Network Integration of This Kinase and Substrates (GeneMANIA website) |
| Enriched GO biological processes of the phosphorylation target genes of the kinase |
| Kinase | GOID | GO term | P.adjust |
| MAP3K3 | ID | Description | 0.00e+00 |
| MAP3K3 | GO:0060537 | muscle tissue development | 1.79e-02 |
| MAP3K3 | GO:0007614 | short-term memory | 1.79e-02 |
| MAP3K3 | GO:0021936 | regulation of cerebellar granule cell precursor proliferation | 1.79e-02 |
| MAP3K3 | GO:0031987 | locomotion involved in locomotory behavior | 1.79e-02 |
| MAP3K3 | GO:0070885 | negative regulation of calcineurin-NFAT signaling cascade | 1.79e-02 |
| MAP3K3 | GO:0106057 | negative regulation of calcineurin-mediated signaling | 1.79e-02 |
| MAP3K3 | GO:0021534 | cell proliferation in hindbrain | 1.79e-02 |
| MAP3K3 | GO:0021924 | cell proliferation in external granule layer | 1.79e-02 |
| MAP3K3 | GO:0021930 | cerebellar granule cell precursor proliferation | 1.79e-02 |
| MAP3K3 | GO:0060033 | anatomical structure regression | 1.79e-02 |
| MAP3K3 | GO:2000345 | regulation of hepatocyte proliferation | 1.79e-02 |
| MAP3K3 | GO:0030903 | notochord development | 1.79e-02 |
| MAP3K3 | GO:0050849 | negative regulation of calcium-mediated signaling | 1.79e-02 |
| MAP3K3 | GO:0072574 | hepatocyte proliferation | 1.79e-02 |
| MAP3K3 | GO:0072575 | epithelial cell proliferation involved in liver morphogenesis | 1.79e-02 |
| MAP3K3 | GO:0072576 | liver morphogenesis | 1.79e-02 |
| MAP3K3 | GO:0097421 | liver regeneration | 1.79e-02 |
| MAP3K3 | GO:0060045 | positive regulation of cardiac muscle cell proliferation | 1.79e-02 |
| MAP3K3 | GO:0009954 | proximal/distal pattern formation | 1.79e-02 |
| MAP3K3 | GO:0021696 | cerebellar cortex morphogenesis | 1.79e-02 |
| MAP3K3 | GO:0055023 | positive regulation of cardiac muscle tissue growth | 1.79e-02 |
| MAP3K3 | GO:0045880 | positive regulation of smoothened signaling pathway | 1.79e-02 |
| MAP3K3 | GO:0045740 | positive regulation of DNA replication | 1.79e-02 |
| MAP3K3 | GO:0048741 | skeletal muscle fiber development | 1.79e-02 |
| MAP3K3 | GO:0060421 | positive regulation of heart growth | 1.79e-02 |
| MAP3K3 | GO:0070884 | regulation of calcineurin-NFAT signaling cascade | 1.79e-02 |
| MAP3K3 | GO:0106056 | regulation of calcineurin-mediated signaling | 1.79e-02 |
| MAP3K3 | GO:0014904 | myotube cell development | 1.79e-02 |
| MAP3K3 | GO:0021983 | pituitary gland development | 1.79e-02 |
| MAP3K3 | GO:0021587 | cerebellum morphogenesis | 1.79e-02 |
| MAP3K3 | GO:0033173 | calcineurin-NFAT signaling cascade | 1.79e-02 |
| MAP3K3 | GO:0021575 | hindbrain morphogenesis | 1.79e-02 |
| MAP3K3 | GO:0060043 | regulation of cardiac muscle cell proliferation | 1.79e-02 |
| MAP3K3 | GO:0097720 | calcineurin-mediated signaling | 1.79e-02 |
| MAP3K3 | GO:0048546 | digestive tract morphogenesis | 1.79e-02 |
| MAP3K3 | GO:0030850 | prostate gland development | 1.79e-02 |
| MAP3K3 | GO:0021695 | cerebellar cortex development | 1.79e-02 |
| MAP3K3 | GO:0046622 | positive regulation of organ growth | 1.79e-02 |
| MAP3K3 | GO:0060038 | cardiac muscle cell proliferation | 1.97e-02 |
| MAP3K3 | GO:0002931 | response to ischemia | 1.97e-02 |
| MAP3K3 | GO:2000179 | positive regulation of neural precursor cell proliferation | 1.97e-02 |
| MAP3K3 | GO:0031100 | animal organ regeneration | 1.97e-02 |
| MAP3K3 | GO:0055021 | regulation of cardiac muscle tissue growth | 1.97e-02 |
| MAP3K3 | GO:1902808 | positive regulation of cell cycle G1/S phase transition | 1.97e-02 |
| MAP3K3 | GO:0001655 | urogenital system development | 1.98e-02 |
| MAP3K3 | GO:0060420 | regulation of heart growth | 2.06e-02 |
| MAP3K3 | GO:0021536 | diencephalon development | 2.24e-02 |
| MAP3K3 | GO:0014855 | striated muscle cell proliferation | 2.26e-02 |
| MAP3K3 | GO:0050848 | regulation of calcium-mediated signaling | 2.26e-02 |
Top |
Related Drugs to MAP3K3_SMURF2 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
| Distribution of the number of studies mentioning MAP3K3-SMURF2 and kinase inhibitors the PubMed Abstract (04-01-2024) |
| Fusion gene - drug pair 1 | Fusion gene - drug pair 2 | PMID | Publication date | DOI | Study title |
Top |
Related Diseases to MAP3K3_SMURF2 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Related diseases from the literature mentioned this fusion gene and drug. (PubMed, 04-01-2024) |
| MeSH ID | MeSH term |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Top |
Clinical Trials of the Found Drugs/Small Molecules |
| Statistics of the Clinical Trials of the Found Kinase Inibitors from clinicaltrials.gov (06-17-2024) |
| Clinical Trials from clinicaltrials.gov (06-17-2024) |
| Fusion Gene | Kinase Inhibitor | NCT ID | Study Status | Phases | Disease | # Enrolment | Date |
Copyright 2024-Present -The University of Texas Health Science Center at Houston
Web File Viewing | Emergency Information |Campus Carry|Site Policies |